Recombinant Mouse Mmp12 protein, His-tagged
Cat.No. : | Mmp12-533M |
Product Overview : | Recombinant Mouse Mmp12 (Ala29-Cys473), fussed with His tag at C-terminal, was expressed in Human Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Human Cells |
Tag : | His |
Protein Length : | Ala29-Cys473 |
Form : | Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4 |
AA Sequence : | APMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQH LRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYF DGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFR LSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSI WPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKH YWRYDVRQELMDPAYPKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGCVDHHH HHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
Shipping : | The product is shipped on dry ice/ice packs. |
Gene Name | Mmp12 matrix metallopeptidase 12 [ Mus musculus ] |
Official Symbol | Mmp12 |
Synonyms | MMP12; matrix metallopeptidase 12; macrophage metalloelastase; MME; MMP-12; macrophage elastase; macrophage-metalloelastase; matrix metalloproteinase 12; matrix metalloproteinase-12; Mmel; AV378681; |
Gene ID | 17381 |
mRNA Refseq | NM_008605 |
Protein Refseq | NP_032631 |
UniProt ID | P34960 |
Chromosome Location | 9 A1; 9 2.46 Cm |
Pathway | Matrix Metalloproteinases, organism-specific biosystem; |
Function | calcium ion binding; hydrolase activity; metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
MMP12-1283H | Recombinant Human MMP12 Protein, His-tagged | +Inquiry |
Mmp12-604R | Recombinant Rat Mmp12 Protein, His-tagged | +Inquiry |
MMP12-01R | Recombinant Rat MMP12 Protein | +Inquiry |
MMP12-5418H | Recombinant Human MMP12 Protein, GST-tagged | +Inquiry |
Mmp12-10592M | Recombinant Mouse Mmp12 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP12-4281HCL | Recombinant Human MMP12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mmp12 Products
Required fields are marked with *
My Review for All Mmp12 Products
Required fields are marked with *
0
Inquiry Basket