Recombinant Mouse Ms4a1 protein, His/SUMO-tagged
| Cat.No. : | Ms4a1-4893M |
| Product Overview : | Recombinant Mouse Ms4a1(132-291aa) fused with His-SUMO tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 132-291aa |
| Molecular Mass : | 34.1kD |
| AA Sequence : | ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGI VENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQE QESLPVENEIAP |
| Gene Name | Ms4a1 membrane-spanning 4-domains, subfamily A, member 1 [ Mus musculus ] |
| Official Symbol | Ms4a1 |
| Synonyms | MS4A1; membrane-spanning 4-domains, subfamily A, member 1; B-lymphocyte antigen CD20; CD20 antigen; lymphocyte antigen 44; B-cell differentiation antigen Ly-44; membrane-spanning 4-domains, subfamily A, member 2; Cd20; Ly-44; Ms4a2; AA960661; |
| Gene ID | 12482 |
| mRNA Refseq | NM_007641 |
| Protein Refseq | NP_031667 |
| MIM | |
| UniProt ID | P19437 |
| Chromosome Location | 19 8.19 cM; 19 B |
| Pathway | Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
| Function | epidermal growth factor receptor binding; |
| ◆ Recombinant Proteins | ||
| MS4A1-3929H | Recombinant Human MS4A1 full length protein, His-tagged(Nanodisc) | +Inquiry |
| MS4A1-10113M | Recombinant Mouse MS4A1 Protein | +Inquiry |
| MS4A1-1135H | Recombinant Human MS4A1 Protein, His&GST-tagged | +Inquiry |
| MS4A1-17HP | Recombinant Human MS4A1 protein, Fc-tagged, R-PE labeled | +Inquiry |
| MS4A1-62C | Recombinant Cynomolgus MS4A1, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MS4A1-1848FCL | Recombinant Ferret MS4A1 cell lysate | +Inquiry |
| MS4A1-819CCL | Recombinant Cynomolgus MS4A1 cell lysate | +Inquiry |
| MS4A1-1542HCL | Recombinant Human MS4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ms4a1 Products
Required fields are marked with *
My Review for All Ms4a1 Products
Required fields are marked with *
