"Ms4a1" Related Products

Expand
Expand
Expand

Recombinant Mouse Ms4a1 protein, His-tagged

Cat.No.: Ms4a1-4896M
Product Overview: Recombinant Mouse Ms4a1(111-291aa) fused with His tag was expressed in Yeast.
Source: Yeast
Species: Mouse
Tag: His
Molecular Mass: 22.3kD
Protein length: 111-291aa
AA Sequence: VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVF LGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEI IPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Gene Name: Ms4a1 membrane-spanning 4-domains, subfamily A, member 1 [ Mus musculus ]
Official Symbol: Ms4a1
Synonyms: MS4A1; membrane-spanning 4-domains, subfamily A, member 1; B-lymphocyte antigen CD20; CD20 antigen; lymphocyte antigen 44; B-cell differentiation antigen Ly-44; membrane-spanning 4-domains, subfamily A, member 2; Cd20; Ly-44; Ms4a2; AA960661;
Gene ID: 12482
mRNA Refseq: NM_007641
Protein Refseq: NP_031667
MIM:
UniProt ID: P19437
Chromosome Location: 19 8.19 cM; 19 B
Pathway: Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function: epidermal growth factor receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.