Recombinant Mouse Ms4a1 protein, His-tagged
| Cat.No. : | Ms4a1-4896M |
| Product Overview : | Recombinant Mouse Ms4a1(111-291aa) fused with His tag was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 111-291aa |
| Molecular Mass : | 22.3kD |
| AA Sequence : | VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVF LGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEI IPVQEEEEEEAEINFPAPPQEQESLPVENEIAP |
| Gene Name | Ms4a1 membrane-spanning 4-domains, subfamily A, member 1 [ Mus musculus ] |
| Official Symbol | Ms4a1 |
| Synonyms | MS4A1; membrane-spanning 4-domains, subfamily A, member 1; B-lymphocyte antigen CD20; CD20 antigen; lymphocyte antigen 44; B-cell differentiation antigen Ly-44; membrane-spanning 4-domains, subfamily A, member 2; Cd20; Ly-44; Ms4a2; AA960661; |
| Gene ID | 12482 |
| mRNA Refseq | NM_007641 |
| Protein Refseq | NP_031667 |
| MIM | |
| UniProt ID | P19437 |
| Chromosome Location | 19 8.19 cM; 19 B |
| Pathway | Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; |
| Function | epidermal growth factor receptor binding; |
| ◆ Cell & Tissue Lysates | ||
| MS4A1-1542HCL | Recombinant Human MS4A1 cell lysate | +Inquiry |
| MS4A1-1848FCL | Recombinant Ferret MS4A1 cell lysate | +Inquiry |
| MS4A1-819CCL | Recombinant Cynomolgus MS4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ms4a1 Products
Required fields are marked with *
My Review for All Ms4a1 Products
Required fields are marked with *
