Recombinant Mouse MSLN Protein (298-600 aa), His-SUMO-tagged
Cat.No. : | MSLN-669M |
Product Overview : | Recombinant Mouse MSLN Protein (298-600 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 298-600 aa |
Description : | Mbrane-anchored forms may play a role in cellular adhesion. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 50.1 kDa |
AA Sequence : | DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Msln mesothelin [ Mus musculus ] |
Official Symbol | MSLN |
Synonyms | MSLN; mesothelin; MPF; |
Gene ID | 56047 |
mRNA Refseq | NM_018857 |
Protein Refseq | NP_061345 |
UniProt ID | Q61468 |
◆ Recombinant Proteins | ||
MSLN-181H | Recombinant Human MSLN Protein, His\Avi-tagged | +Inquiry |
MSLN-1139H | Recombinant Human MSLN Protein, His-tagged | +Inquiry |
Msln-35M | Recombinant Mouse Msln Protein, Fc-tagged | +Inquiry |
MSLN-3297H | Recombinant Human MSLN protein(Glu296-Gly580), His-tagged | +Inquiry |
MSLN-8392H | Active Recombinant Human MSLN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSLN-1316HCL | Recombinant Human MSLN cell lysate | +Inquiry |
MSLN-1343HCL | Recombinant Human MSLN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSLN Products
Required fields are marked with *
My Review for All MSLN Products
Required fields are marked with *
0
Inquiry Basket