Recombinant Mouse MSLN Protein (298-600 aa), His-SUMO-tagged

Cat.No. : MSLN-669M
Product Overview : Recombinant Mouse MSLN Protein (298-600 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 298-600 aa
Description : Mbrane-anchored forms may play a role in cellular adhesion.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 50.1 kDa
AA Sequence : DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name Msln mesothelin [ Mus musculus ]
Official Symbol MSLN
Synonyms MSLN; mesothelin; MPF;
Gene ID 56047
mRNA Refseq NM_018857
Protein Refseq NP_061345
UniProt ID Q61468

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSLN Products

Required fields are marked with *

My Review for All MSLN Products

Required fields are marked with *

0
cart-icon
0
compare icon