Recombinant Mouse MUP2 Protein (19-180 aa), His-tagged
Cat.No. : | MUP2-1575M |
Product Overview : | Recombinant Mouse MUP2 Protein (19-180 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 19-180 aa |
Description : | Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 20.7 kDa |
AA Sequence : | EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Mup2 major urinary protein 2 [ Mus musculus (house mouse) ] |
Official Symbol | MUP2 |
Synonyms | Mup4; Mup-2; Mup18; AA589603; |
Gene ID | 17841 |
UniProt ID | P11589 |
◆ Recombinant Proteins | ||
MUP2-1575M | Recombinant Mouse MUP2 Protein (19-180 aa), His-tagged | +Inquiry |
MUP2-876M | Recombinant Mouse MUP2 Protein (19-180 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MUP2 Products
Required fields are marked with *
My Review for All MUP2 Products
Required fields are marked with *
0
Inquiry Basket