Recombinant Mouse NKX2-1 Protein, His-tagged
| Cat.No. : | NKX2-1-10697M |
| Product Overview : | Recombinant Mouse NKX2-1 Protein(NP_033411.3), fused to His-tag, was expressed in E. coli. |
| Availability | February 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Form : | PBS buffer |
| Molecular Mass : | The protein has a calculated MW of 40 kDa. |
| AA Sequence : | MHHHHHHSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPAAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGGAGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQSHAQQQAQQQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAGLQGQVSSLSHLNSSGSDYGAMSCSTLLYGRTW |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.1 mg/ml |
| Gene Name | Nkx2-1 NK2 homeobox 1 [ Mus musculus (house mouse) ] |
| Official Symbol | NKX2-1 |
| Synonyms | ti; T/EB; Titf; T/EBP; Titf1; Ttf-1; Nkx2.1; AV026640 |
| Gene ID | 21869 |
| mRNA Refseq | NM_009385.3 |
| Protein Refseq | NP_033411.3 |
| UniProt ID | P50220 |
| ◆ Recombinant Proteins | ||
| NKX2-1-6184C | Recombinant Chicken NKX2-1 | +Inquiry |
| NKX2-1-02H | Recombinant Human NKX2-1 Protein, GST-tagged | +Inquiry |
| NKX2-1-6855HF | Recombinant Full Length Human NKX2-1 Protein, GST-tagged | +Inquiry |
| NKX2-1-226H | Recombinant Human NK2 Homeobox 1 | +Inquiry |
| NKX2-1-384H | Recombinant Human NKX2-1 Protein, His&GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX2-1 Products
Required fields are marked with *
My Review for All NKX2-1 Products
Required fields are marked with *
