Recombinant Mouse NKX2-1 Protein, His-tagged

• Cat.No.: NKX2-1-10697M
• Product Overview: Recombinant Mouse NKX2-1 Protein(NP_033411.3), fused to His-tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Form: PBS buffer
• Molecular Mass: The protein has a calculated MW of 40 kDa.
• AA Sequence: MHHHHHHSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPAAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGGAGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQSHAQQQAQQQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAGLQGQVSSLSHLNSSGSDYGAMSCSTLLYGRTW
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.1 mg/ml

Gene Information

• Gene Name: Nkx2-1 NK2 homeobox 1 [ Mus musculus (house mouse) ]
• Official Symbol: NKX2-1
• Synonyms: ti; T/EB; Titf; T/EBP; Titf1; Ttf-1; Nkx2.1; AV026640
• Gene ID: 21869
• mRNA Refseq: NM_009385.3
• Protein Refseq: NP_033411.3
• UniProt ID: P50220