Recombinant Mouse NKX2-1 Protein, His-tagged
Cat.No. : | NKX2-1-10697M |
Product Overview : | Recombinant Mouse NKX2-1 Protein(NP_033411.3), fused to His-tag, was expressed in E. coli. |
Availability | May 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Form : | PBS buffer |
Molecular Mass : | The protein has a calculated MW of 40 kDa. |
AA Sequence : | MHHHHHHSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPAAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGGAGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQSHAQQQAQQQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAGLQGQVSSLSHLNSSGSDYGAMSCSTLLYGRTW |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.1 mg/ml |
Gene Name | Nkx2-1 NK2 homeobox 1 [ Mus musculus (house mouse) ] |
Official Symbol | NKX2-1 |
Synonyms | ti; T/EB; Titf; T/EBP; Titf1; Ttf-1; Nkx2.1; AV026640 |
Gene ID | 21869 |
mRNA Refseq | NM_009385.3 |
Protein Refseq | NP_033411.3 |
UniProt ID | P50220 |
◆ Recombinant Proteins | ||
NKX2-1-6184C | Recombinant Chicken NKX2-1 | +Inquiry |
NKX2-1-5133H | Recombinant Human NKX2-1 Protein (Ala40-Pro111), N-GST tagged | +Inquiry |
NKX2-1-01H | Recombinant Human NKX2-1 Protein, GST-tagged | +Inquiry |
NKX2-1-10697M | Recombinant Mouse NKX2-1 Protein, His-tagged | +Inquiry |
NKX2-1-3277H | Recombinant Human NKX2-1 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NKX2-1 Products
Required fields are marked with *
My Review for All NKX2-1 Products
Required fields are marked with *
0
Inquiry Basket