Recombinant Mouse NLRP3 Protein, His tagged

Cat.No. : NLRP3-10722ME
Product Overview : Recombinant Mouse NLRP3 Protein with His-tag was expressed in E. coli.
Availability November 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Enables DNA-binding transcription factor binding activity and sequence-specific DNA binding activity. Involved in several processes, including positive regulation of T-helper cell differentiation; positive regulation of cytokine production; and response to bacterium. Acts upstream of or within several processes, including NLRP3 inflammasome complex assembly; activation of cysteine-type endopeptidase activity involved in apoptotic process; and defense response to virus. Located in cytoplasm and nucleus. Part of NLRP3 inflammasome complex. Is expressed in central nervous system and retina. Used to study CINCA Syndrome; familial cold autoinflammatory syndrome 1; and non-alcoholic fatty liver disease. Human ortholog(s) of this gene implicated in CINCA Syndrome; Muckle-Wells syndrome; autosomal dominant nonsyndromic deafness 34; familial cold autoinflammatory syndrome 1; and urticaria. Orthologous to human NLRP3 (NLR family pyrin domain containing 3).
Molecular Mass : The protein has a calculated MW of 36.17 kDa.
AA Sequence : MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNARLGESVDLNSRYTQLQLVKEHPSKQEREHELLTIGRTKMRDSPMSSLKLELLFEPEDGHSEPVHTVVFQGAAGIGKTILARKIMLDWALGKLFKDKFDYLFFIHCREVSLRTPRSLADLIVSCWPDPNPPVCKILRKPSRILFLMDGFDELQGAFDEH
Gene Name Nlrp3 NLR family, pyrin domain containing 3 [ Mus musculus (house mouse) ]
Official Symbol NLRP3
Synonyms NLRP3; NLR family, pyrin domain containing 3; NACHT, LRR and PYD domains-containing protein 3; cryopyrin; PYRIN-containing APAF1-like protein 1; cold autoinflammatory syndrome 1 homolog; mast cell maturation inducible protein 1; NACHT/LRR/pyrin domain-containing protein 3; cold autoinflammatory syndrome 1 protein homolog; mast cell maturation-associated-inducible protein 1; FCU; MWS; FCAS; Cias1; Mmig1; NALP3; Pypaf1; AII/AVP; AGTAVPRL; MGC129375
Gene ID 216799
mRNA Refseq NM_145827
Protein Refseq NP_665826

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NLRP3 Products

Required fields are marked with *

My Review for All NLRP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon