Recombinant Mouse NLRP3 Protein, His tagged

• Cat.No.: NLRP3-10722ME
• Product Overview: Recombinant Mouse NLRP3 Protein with His-tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Enables DNA-binding transcription factor binding activity and sequence-specific DNA binding activity. Involved in several processes, including positive regulation of T-helper cell differentiation; positive regulation of cytokine production; and response to bacterium. Acts upstream of or within several processes, including NLRP3 inflammasome complex assembly; activation of cysteine-type endopeptidase activity involved in apoptotic process; and defense response to virus. Located in cytoplasm and nucleus. Part of NLRP3 inflammasome complex. Is expressed in central nervous system and retina. Used to study CINCA Syndrome; familial cold autoinflammatory syndrome 1; and non-alcoholic fatty liver disease. Human ortholog(s) of this gene implicated in CINCA Syndrome; Muckle-Wells syndrome; autosomal dominant nonsyndromic deafness 34; familial cold autoinflammatory syndrome 1; and urticaria. Orthologous to human NLRP3 (NLR family pyrin domain containing 3).
• Molecular Mass: The protein has a calculated MW of 36.17 kDa.
• AA Sequence: MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNARLGESVDLNSRYTQLQLVKEHPSKQEREHELLTIGRTKMRDSPMSSLKLELLFEPEDGHSEPVHTVVFQGAAGIGKTILARKIMLDWALGKLFKDKFDYLFFIHCREVSLRTPRSLADLIVSCWPDPNPPVCKILRKPSRILFLMDGFDELQGAFDEH

Gene Information

• Gene Name: Nlrp3 NLR family, pyrin domain containing 3 [ Mus musculus (house mouse) ]
• Official Symbol: NLRP3
• Synonyms: NLRP3; NLR family, pyrin domain containing 3; NACHT, LRR and PYD domains-containing protein 3; cryopyrin; PYRIN-containing APAF1-like protein 1; cold autoinflammatory syndrome 1 homolog; mast cell maturation inducible protein 1; NACHT/LRR/pyrin domain-containing protein 3; cold autoinflammatory syndrome 1 protein homolog; mast cell maturation-associated-inducible protein 1; FCU; MWS; FCAS; Cias1; Mmig1; NALP3; Pypaf1; AII/AVP; AGTAVPRL; MGC129375
• Gene ID: 216799
• mRNA Refseq: NM_145827
• Protein Refseq: NP_665826