Recombinant Mouse NLRP3 Protein, His tagged
Cat.No. : | NLRP3-10722ME |
Product Overview : | Recombinant Mouse NLRP3 Protein with His-tag was expressed in E. coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Enables DNA-binding transcription factor binding activity and sequence-specific DNA binding activity. Involved in several processes, including positive regulation of T-helper cell differentiation; positive regulation of cytokine production; and response to bacterium. Acts upstream of or within several processes, including NLRP3 inflammasome complex assembly; activation of cysteine-type endopeptidase activity involved in apoptotic process; and defense response to virus. Located in cytoplasm and nucleus. Part of NLRP3 inflammasome complex. Is expressed in central nervous system and retina. Used to study CINCA Syndrome; familial cold autoinflammatory syndrome 1; and non-alcoholic fatty liver disease. Human ortholog(s) of this gene implicated in CINCA Syndrome; Muckle-Wells syndrome; autosomal dominant nonsyndromic deafness 34; familial cold autoinflammatory syndrome 1; and urticaria. Orthologous to human NLRP3 (NLR family pyrin domain containing 3). |
Molecular Mass : | The protein has a calculated MW of 36.17 kDa. |
AA Sequence : | MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNARLGESVDLNSRYTQLQLVKEHPSKQEREHELLTIGRTKMRDSPMSSLKLELLFEPEDGHSEPVHTVVFQGAAGIGKTILARKIMLDWALGKLFKDKFDYLFFIHCREVSLRTPRSLADLIVSCWPDPNPPVCKILRKPSRILFLMDGFDELQGAFDEH |
Gene Name | Nlrp3 NLR family, pyrin domain containing 3 [ Mus musculus (house mouse) ] |
Official Symbol | NLRP3 |
Synonyms | NLRP3; NLR family, pyrin domain containing 3; NACHT, LRR and PYD domains-containing protein 3; cryopyrin; PYRIN-containing APAF1-like protein 1; cold autoinflammatory syndrome 1 homolog; mast cell maturation inducible protein 1; NACHT/LRR/pyrin domain-containing protein 3; cold autoinflammatory syndrome 1 protein homolog; mast cell maturation-associated-inducible protein 1; FCU; MWS; FCAS; Cias1; Mmig1; NALP3; Pypaf1; AII/AVP; AGTAVPRL; MGC129375 |
Gene ID | 216799 |
mRNA Refseq | NM_145827 |
Protein Refseq | NP_665826 |
◆ Recombinant Proteins | ||
Nlrp3-1748M | Recombinant Mouse Nlrp3 protein, His-tagged | +Inquiry |
NLRP3-185H | Recombinant Human NLRP3 protein, GST-tagged | +Inquiry |
NLRP3-10722ME | Recombinant Mouse NLRP3 Protein, His tagged | +Inquiry |
Nlrp3-4651M | Recombinant Mouse Nlrp3 protein, His-SUMO-tagged | +Inquiry |
NLRP3-186H | Recombinant Human NLRP3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLRP3-3799HCL | Recombinant Human NLRP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NLRP3 Products
Required fields are marked with *
My Review for All NLRP3 Products
Required fields are marked with *