Recombinant Mouse Nptx1 protein, His-tagged
Cat.No. : | Nptx1-4532M |
Product Overview : | Recombinant Mouse Nptx1 protein(Q62443)(23-432aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-432aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QDFGPTRFICTSVPVDADMCAASVAAGGAEELRSNVLQLRETVLQQKETILSQKETIRELTTKLGRCESQSTLDSGPGEARSGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDDLERQVLSRVNTLEEGKGGPKNDTEERAKIESALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSAAPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGNGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSSKALSGNVIAWAESQIEIFGGATKWTFEACRQIN |
Gene Name | Nptx1 neuronal pentraxin 1 [ Mus musculus ] |
Official Symbol | Nptx1 |
Synonyms | NPTX1; neuronal pentraxin 1; neuronal pentraxin-1; NP-I; neuronal pentraxin I; Np1; D11Bwg1004e; |
Gene ID | 18164 |
mRNA Refseq | NM_008730 |
Protein Refseq | NP_032756 |
◆ Recombinant Proteins | ||
NPTX1-623H | Recombinant Human NPTX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NPTX1-2903R | Recombinant Rhesus Macaque NPTX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nptx1-4532M | Recombinant Mouse Nptx1 protein, His-tagged | +Inquiry |
NPTX1-6651HF | Recombinant Full Length Human NPTX1 Protein, GST-tagged | +Inquiry |
NPTX1-4054R | Recombinant Rat NPTX1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nptx1 Products
Required fields are marked with *
My Review for All Nptx1 Products
Required fields are marked with *
0
Inquiry Basket