Recombinant Mouse Nqo1 protein, His-SUMO-tagged

• Cat.No.: Nqo1-4512M
• Product Overview: Recombinant Mouse Nqo1 protein(Q64669)(2-274aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 2-274aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.8 kDa
• AA Sequence: AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Nqo1 NAD(P)H dehydrogenase, quinone 1 [ Mus musculus ]
• Official Symbol: Nqo1
• Synonyms: NQO1; NAD(P)H dehydrogenase, quinone 1; NAD(P)H dehydrogenase [quinone] 1; azoreductase; DT-diaphorase; menadione reductase; quinone reductase 1; phylloquinone reductase; diaphorase 4 (NADH/NADPH); NAD(P)H dehydrogenase (quinone); NAD(P)H:quinone oxidoreductase 1; NAD(P)H menadione oxidoreductase 1, dioxin inducible; Dtd; Ox1; Qr1; Dia4; Nmo1; Ox-1; Nmo-1; Nmor1; AV001255
• Gene ID: 18104
• mRNA Refseq: NM_008706
• Protein Refseq: NP_032732