Recombinant Mouse Nqo1 protein, His-SUMO-tagged
Cat.No. : | Nqo1-4512M |
Product Overview : | Recombinant Mouse Nqo1 protein(Q64669)(2-274aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-274aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.8 kDa |
AA Sequence : | AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Nqo1 NAD(P)H dehydrogenase, quinone 1 [ Mus musculus ] |
Official Symbol | Nqo1 |
Synonyms | NQO1; NAD(P)H dehydrogenase, quinone 1; NAD(P)H dehydrogenase [quinone] 1; azoreductase; DT-diaphorase; menadione reductase; quinone reductase 1; phylloquinone reductase; diaphorase 4 (NADH/NADPH); NAD(P)H dehydrogenase (quinone); NAD(P)H:quinone oxidoreductase 1; NAD(P)H menadione oxidoreductase 1, dioxin inducible; Dtd; Ox1; Qr1; Dia4; Nmo1; Ox-1; Nmo-1; Nmor1; AV001255; |
Gene ID | 18104 |
mRNA Refseq | NM_008706 |
Protein Refseq | NP_032732 |
◆ Recombinant Proteins | ||
Nqo1-5780M | Recombinant Mouse Nqo1 protein, His-tagged | +Inquiry |
Nqo1-4512M | Recombinant Mouse Nqo1 protein, His-SUMO-tagged | +Inquiry |
NQO1-138H | Recombinant Human NQO1 protein, His-tagged | +Inquiry |
NQO1-6683HF | Recombinant Full Length Human NQO1 Protein, GST-tagged | +Inquiry |
Nqo1-1920R | Recombinant Rat Nqo1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NQO1-3725HCL | Recombinant Human NQO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nqo1 Products
Required fields are marked with *
My Review for All Nqo1 Products
Required fields are marked with *
0
Inquiry Basket