Recombinant Mouse Nqo1 protein, His-SUMO-tagged

Cat.No. : Nqo1-4512M
Product Overview : Recombinant Mouse Nqo1 protein(Q64669)(2-274aa), fused to N-terminal His-SUMO tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 2-274aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 43.8 kDa
AA Sequence : AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Nqo1 NAD(P)H dehydrogenase, quinone 1 [ Mus musculus ]
Official Symbol Nqo1
Synonyms NQO1; NAD(P)H dehydrogenase, quinone 1; NAD(P)H dehydrogenase [quinone] 1; azoreductase; DT-diaphorase; menadione reductase; quinone reductase 1; phylloquinone reductase; diaphorase 4 (NADH/NADPH); NAD(P)H dehydrogenase (quinone); NAD(P)H:quinone oxidoreductase 1; NAD(P)H menadione oxidoreductase 1, dioxin inducible; Dtd; Ox1; Qr1; Dia4; Nmo1; Ox-1; Nmo-1; Nmor1; AV001255;
Gene ID 18104
mRNA Refseq NM_008706
Protein Refseq NP_032732

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Nqo1 Products

Required fields are marked with *

My Review for All Nqo1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon