Recombinant Mouse NUS1 Protein (24-120 aa), His-tagged

Cat.No. : NUS1-1705M
Product Overview : Recombinant Mouse NUS1 Protein (24-120 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 24-120 aa
Description : With DHDDS, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precusrosor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol. Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 13.0 kDa
AA Sequence : SWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPRAVGRNRRHHRHPHGGPGPGPGPAATHPRLRWRADVRSLQKLPVHMGLLVTEEVQEPSFSD
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Nus1 nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) [ Mus musculus ]
Official Symbol NUS1
Synonyms NUS1; nogo-B receptor; ngBR; AU019165; AW538011; BC003223; D10Ertd438e; MGC7199; 1600027K07Rik;
Gene ID 52014
mRNA Refseq NM_030250
Protein Refseq NP_084526
UniProt ID Q99LJ8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUS1 Products

Required fields are marked with *

My Review for All NUS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon