Recombinant Mouse Nus1 protein, His-tagged

Cat.No. : Nus1-5632M
Product Overview : Recombinant Mouse Nus1 protein(Q99LJ8)(140-297aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 140-297aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 19.2 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : DHQGIFKRNNSRLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQDLNCPSAVKVLSPEDGKADIVRAAQDFCQLVAQQQRKPTDLDVDLLGSLLSSHGFPDPDLVLKFGPVDSTLGFLPWQIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK
Gene Name Nus1 nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) [ Mus musculus ]
Official Symbol Nus1
Synonyms NUS1; nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae); nogo-B receptor; ngBR; AU019165; AW538011; BC003223; D10Ertd438e; MGC7199; 1600027K07Rik;
Gene ID 52014
mRNA Refseq NM_030250
Protein Refseq NP_084526

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Nus1 Products

Required fields are marked with *

My Review for All Nus1 Products

Required fields are marked with *

0
cart-icon
0
compare icon