Recombinant Mouse Nus1 protein, His-tagged
| Cat.No. : | Nus1-5632M |
| Product Overview : | Recombinant Mouse Nus1 protein(Q99LJ8)(140-297aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 140-297aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 19.2 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | DHQGIFKRNNSRLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQDLNCPSAVKVLSPEDGKADIVRAAQDFCQLVAQQQRKPTDLDVDLLGSLLSSHGFPDPDLVLKFGPVDSTLGFLPWQIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK |
| Gene Name | Nus1 nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) [ Mus musculus ] |
| Official Symbol | Nus1 |
| Synonyms | NUS1; nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae); nogo-B receptor; ngBR; AU019165; AW538011; BC003223; D10Ertd438e; MGC7199; 1600027K07Rik; |
| Gene ID | 52014 |
| mRNA Refseq | NM_030250 |
| Protein Refseq | NP_084526 |
| ◆ Recombinant Proteins | ||
| NUS1-11009M | Recombinant Mouse NUS1 Protein | +Inquiry |
| RFL9982SF | Recombinant Full Length Saccharomyces Cerevisiae Probable Undecaprenyl Pyrophosphate Synthase(Nus1) Protein, His-Tagged | +Inquiry |
| NUS1-1424H | Recombinant Human NUS1, His-tagged | +Inquiry |
| NUS1-6281M | Recombinant Mouse NUS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Nus1-5632M | Recombinant Mouse Nus1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NUS1-3623HCL | Recombinant Human NUS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nus1 Products
Required fields are marked with *
My Review for All Nus1 Products
Required fields are marked with *
