Recombinant Mouse OCM Protein (2-109 aa), His-tagged
Cat.No. : | OCM-1974M |
Product Overview : | Recombinant Mouse OCM Protein (2-109 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-109 aa |
Description : | Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.1 kDa |
AA Sequence : | SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Ocm oncomodulin [ Mus musculus ] |
Official Symbol | OCM |
Synonyms | OCM; oncomodulin; OM; parvalbumin beta; |
Gene ID | 18261 |
mRNA Refseq | NM_033039 |
Protein Refseq | NP_149028 |
UniProt ID | P51879 |
◆ Recombinant Proteins | ||
OCM-4154R | Recombinant Rat OCM Protein | +Inquiry |
OCM-771H | Recombinant Human OCM Protein, His-tagged | +Inquiry |
OCM-5992C | Recombinant Chicken OCM | +Inquiry |
OCM-3693H | Recombinant Human OCM, His-tagged | +Inquiry |
OCM-1974M | Recombinant Mouse OCM Protein (2-109 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OCM-453HCL | Recombinant Human OCM lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OCM Products
Required fields are marked with *
My Review for All OCM Products
Required fields are marked with *