"OCM" Related Products

Expand
Expand

Recombinant Mouse OCM Protein (2-109 aa), His-tagged

Cat.No.: OCM-1974M
Product Overview: Recombinant Mouse OCM Protein (2-109 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein.
Description: Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
Source: Yeast
Species: Mouse
Tag : His
Form: Tris-based buffer,50% glycerol
Molecular Mass: 14.1 kDa
Protein length: 2-109 aa
AA Sequence: SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Purity: > 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name: Ocm oncomodulin [ Mus musculus ]
Official Symbol: OCM
Synonyms: OCM; oncomodulin; OM; parvalbumin beta;
Gene ID: 18261
mRNA Refseq: NM_033039
Protein Refseq: NP_149028
UniProt ID: P51879

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.