Recombinant Mouse OCM Protein (2-109 aa), His-tagged
| Cat.No. : | OCM-1974M |
| Product Overview : | Recombinant Mouse OCM Protein (2-109 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 2-109 aa |
| Description : | Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 14.1 kDa |
| AA Sequence : | SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Ocm oncomodulin [ Mus musculus ] |
| Official Symbol | OCM |
| Synonyms | OCM; oncomodulin; OM; parvalbumin beta; |
| Gene ID | 18261 |
| mRNA Refseq | NM_033039 |
| Protein Refseq | NP_149028 |
| UniProt ID | P51879 |
| ◆ Recombinant Proteins | ||
| OCM-119M | Recombinant Mouse OCM Protein | +Inquiry |
| Ocm-4444R | Recombinant Rat Ocm protein, His-tagged | +Inquiry |
| OCM-3693H | Recombinant Human OCM, His-tagged | +Inquiry |
| Ocm-4570M | Recombinant Mouse Ocm Protein, Myc/DDK-tagged | +Inquiry |
| OCM-4154R | Recombinant Rat OCM Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OCM-453HCL | Recombinant Human OCM lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OCM Products
Required fields are marked with *
My Review for All OCM Products
Required fields are marked with *
