Recombinant Mouse Otx2 protein, His-tagged
Cat.No. : | Otx2-3311M |
Product Overview : | Recombinant Mouse Otx2 protein(P80206)(1-289aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-289aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.6 kDa |
AA Sequence : | MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKSSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Otx2 orthodenticle homolog 2 (Drosophila) [ Mus musculus ] |
Official Symbol | Otx2 |
Synonyms | OTX2; orthodenticle homolog 2 (Drosophila); homeobox protein OTX2; E130306E05Rik; |
Gene ID | 18424 |
mRNA Refseq | NM_144841 |
Protein Refseq | NP_659090 |
◆ Recombinant Proteins | ||
OTX2-4776H | Recombinant Human OTX2 Protein (Met1-Leu297), C-His tagged | +Inquiry |
OTX2-390H | Recombinant Human OTX2 Protein, His-tagged | +Inquiry |
OTX2-3310H | Recombinant Human OTX2 protein, His-SUMO-tagged | +Inquiry |
OTX2-25H | Recombinant Human OTX2 Protein, His-tagged | +Inquiry |
OTX2-6089C | Recombinant Chicken OTX2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
OTX2-3511HCL | Recombinant Human OTX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Otx2 Products
Required fields are marked with *
My Review for All Otx2 Products
Required fields are marked with *
0
Inquiry Basket