Recombinant Mouse Oxt protein, His&Myc-tagged
| Cat.No. : | Oxt-3315M |
| Product Overview : | Recombinant Mouse Oxt protein(P35454)(32-125aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 32-125aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.1 kDa |
| AA Sequence : | AVLDLDMRKCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAATGICCSPDGCRTDPACDPESAFSER |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Oxt oxytocin [ Mus musculus ] |
| Official Symbol | Oxt |
| Synonyms | OXT; oxytocin; oxytocin-neurophysin 1; OT-NPI; OT; Oxy; |
| Gene ID | 18429 |
| mRNA Refseq | NM_011025 |
| Protein Refseq | NP_035155 |
| ◆ Recombinant Proteins | ||
| OXT-1488H | Recombinant Human OXT, GST-tagged | +Inquiry |
| OXT-5047H | Recombinant Human OXT protein, His&Myc-tagged | +Inquiry |
| Oxt-3315M | Recombinant Mouse Oxt protein, His&Myc-tagged | +Inquiry |
| OXT-3887R | Recombinant Rat OXT Protein, His (Fc)-Avi-tagged | +Inquiry |
| OXT-3314H | Recombinant Human OXT protein, His-SUMO & Myc-tagged | +Inquiry |
| ◆ Native Proteins | ||
| OXT-5360H | Native Human Oxytocin, Prepropeptide | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OXT-3503HCL | Recombinant Human OXT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Oxt Products
Required fields are marked with *
My Review for All Oxt Products
Required fields are marked with *



