Recombinant Mouse Pdgfd protein, His/SUMO-tagged
| Cat.No. : | Pdgfd-390M |
| Product Overview : | Recombinant Mouse Pdgfd(24-370aa) fused with His/SUMO tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 24-370aa |
| Form : | 20mM Tris-HCl based buffer,pH8.0 |
| Molecular Mass : | 56.2kD |
| AA Sequence : | TPQRASIKALRNANLRRDESNHLTDLYQREENIQVTSNGHVQSPRFPNSYPRNLLLTWWLRSQEKTRIQLSFDHQ FGLEEAENDICRYDFVEVEEVSESSTVVRGRWCGHKEIPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDF QPEAASETNWESVTSSFSGVSYHSPSITDPTLTADALDKTVAEFDTVEDLLKHFNPVSWQDDLENLYLDTPHYRG RSYHDRKSKVDLDRLNDDVKRYSCTPRNHSVNLREELKLTNAVFFPRCLLVQRCGGNCGCGTVNWKSCTCSSGKT VKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERCDCICSSRPPR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. |
| Gene Name | Pdgfd platelet-derived growth factor, D polypeptide [ Mus musculus ] |
| Official Symbol | Pdgfd |
| Synonyms | PDGFD; platelet-derived growth factor, D polypeptide; platelet-derived growth factor D; PDGF-D; SCDGF-B; spinal cord-derived growth factor B; 1110003I09Rik; |
| Gene ID | 71785 |
| mRNA Refseq | NM_027924 |
| Protein Refseq | NP_082200 |
| MIM | |
| UniProt ID | Q925I7 |
| Chromosome Location | 9; 9 A1 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Gap junction, organism-specific biosystem; Gap junction, conserved biosystem; |
| Function | growth factor activity; platelet-derived growth factor receptor binding; |
| ◆ Recombinant Proteins | ||
| PDGFD-209P | Active Recombinant Human PDGFDD Protein | +Inquiry |
| PDGFD-1526C | Recombinant Cynomolgus PDGFD protein, His-tagged | +Inquiry |
| PDGFD-4605H | Recombinant Human PDGFD protein, His-tagged | +Inquiry |
| Pdgfd-8157R | Recombinant Rat Pdgfd protein, His-tagged | +Inquiry |
| PDGFD-207H | Recombinant Human PDGFD, His tagged | +Inquiry |
| ◆ Native Proteins | ||
| PDGFD-4339R | Recombinant Rat PDGFD Protein, His tagged, Homodimer | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PDGFD-3336HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
| PDGFD-3335HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pdgfd Products
Required fields are marked with *
My Review for All Pdgfd Products
Required fields are marked with *
