Recombinant Mouse Pdgfd protein, His/SUMO-tagged
Cat.No. : | Pdgfd-390M |
Product Overview : | Recombinant Mouse Pdgfd(24-370aa) fused with His/SUMO tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-370aa |
Form : | 20mM Tris-HCl based buffer,pH8.0 |
Molecular Mass : | 56.2kD |
AA Sequence : | TPQRASIKALRNANLRRDESNHLTDLYQREENIQVTSNGHVQSPRFPNSYPRNLLLTWWLRSQEKTRIQLSFDHQ FGLEEAENDICRYDFVEVEEVSESSTVVRGRWCGHKEIPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDF QPEAASETNWESVTSSFSGVSYHSPSITDPTLTADALDKTVAEFDTVEDLLKHFNPVSWQDDLENLYLDTPHYRG RSYHDRKSKVDLDRLNDDVKRYSCTPRNHSVNLREELKLTNAVFFPRCLLVQRCGGNCGCGTVNWKSCTCSSGKT VKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERCDCICSSRPPR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. |
Gene Name | Pdgfd platelet-derived growth factor, D polypeptide [ Mus musculus ] |
Official Symbol | Pdgfd |
Synonyms | PDGFD; platelet-derived growth factor, D polypeptide; platelet-derived growth factor D; PDGF-D; SCDGF-B; spinal cord-derived growth factor B; 1110003I09Rik; |
Gene ID | 71785 |
mRNA Refseq | NM_027924 |
Protein Refseq | NP_082200 |
MIM | |
UniProt ID | Q925I7 |
Chromosome Location | 9; 9 A1 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Gap junction, organism-specific biosystem; Gap junction, conserved biosystem; |
Function | growth factor activity; platelet-derived growth factor receptor binding; |
◆ Recombinant Proteins | ||
PDGFD-2572H | Recombinant Human PDGFD Protein, His-tagged | +Inquiry |
PDGFD-6596M | Recombinant Mouse PDGFD Protein, His (Fc)-Avi-tagged | +Inquiry |
PDGFD-4471H | Recombinant Human PDGFD Protein, His (Fc)-Avi-tagged | +Inquiry |
PDGFD-12569M | Recombinant Mouse Pdgfd Protein, Ser250-Arg370 | +Inquiry |
PDGFD-1611H | Recombinant Human PDGFD, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFD-3335HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
PDGFD-3336HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pdgfd Products
Required fields are marked with *
My Review for All Pdgfd Products
Required fields are marked with *