Recombinant Mouse Pgam1 Protein, His-tagged
Cat.No. : | Pgam1-7297M |
Product Overview : | Recombinant mouse PGAM1 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-254 |
Description : | Interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. Can also catalyze the reaction of EC 5.4.2.4 (synthase), but with a reduced activity. |
Form : | Liquid |
Molecular Mass : | 31.4 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSHMAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKVKK |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol, 0.1 M NaCl, 1 mM DTT |
Gene Name | Pgam1 phosphoglycerate mutase 1 [ Mus musculus (house mouse) ] |
Official Symbol | Pgam1 |
Synonyms | Pgam1; phosphoglycerate mutase 1; Pgam; Pgam-1; 2310050F24Rik; phosphoglycerate mutase 1; BPG-dependent PGAM 1; PGAM-B; phosphoglycerate mutase isozyme B; EC 5.4.2.11; EC 5.4.2.4 |
Gene ID | 18648 |
mRNA Refseq | NM_023418 |
Protein Refseq | NP_075907 |
UniProt ID | Q9DBJ1 |
◆ Recombinant Proteins | ||
PGAM1-4059R | Recombinant Rat PGAM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PGAM1-1661H | Recombinant Human PGAM1 protein, His-tagged | +Inquiry |
PGAM1-3199C | Recombinant Chicken PGAM1 | +Inquiry |
PGAM1-0574H | Recombinant Human PGAM1 Protein (M1-K254), Tag Free | +Inquiry |
Pgam1-7297M | Recombinant Mouse Pgam1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGAM1-3264HCL | Recombinant Human PGAM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pgam1 Products
Required fields are marked with *
My Review for All Pgam1 Products
Required fields are marked with *