Recombinant Mouse Pgam1 Protein, His-tagged

Cat.No. : Pgam1-7297M
Product Overview : Recombinant mouse PGAM1 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-254
Description : Interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. Can also catalyze the reaction of EC 5.4.2.4 (synthase), but with a reduced activity.
Form : Liquid
Molecular Mass : 31.4 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSHMAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKVKK
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol, 0.1 M NaCl, 1 mM DTT
Gene Name Pgam1 phosphoglycerate mutase 1 [ Mus musculus (house mouse) ]
Official Symbol Pgam1
Synonyms Pgam1; phosphoglycerate mutase 1; Pgam; Pgam-1; 2310050F24Rik; phosphoglycerate mutase 1; BPG-dependent PGAM 1; PGAM-B; phosphoglycerate mutase isozyme B; EC 5.4.2.11; EC 5.4.2.4
Gene ID 18648
mRNA Refseq NM_023418
Protein Refseq NP_075907
UniProt ID Q9DBJ1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Pgam1 Products

Required fields are marked with *

My Review for All Pgam1 Products

Required fields are marked with *

0
cart-icon