Recombinant Mouse PLAA Protein (495-584 aa), His-Myc-tagged
Cat.No. : | PLAA-2695M |
Product Overview : | Recombinant Mouse PLAA Protein (495-584 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 495-584 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.7 kDa |
AA Sequence : | TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Plaa phospholipase A2, activating protein [ Mus musculus ] |
Official Symbol | PLAA |
Synonyms | PLAA; PLAP; Ufd3; PLA2P; AI536418; AU018445; AW208417; 2410007N06; D4Ertd618e; |
Gene ID | 18786 |
mRNA Refseq | NM_172695 |
Protein Refseq | NP_766283 |
UniProt ID | P27612 |
◆ Recombinant Proteins | ||
PLAA-4491R | Recombinant Rat PLAA Protein | +Inquiry |
PLAA-2597H | Recombinant Human PLAA protein, His-tagged | +Inquiry |
PLAA-2599H | Recombinant Human PLAA protein, His & GST-tagged | +Inquiry |
PLAA-723HF | Recombinant Full Length Human PLAA Protein, GST-tagged | +Inquiry |
PLAA-3456R | Recombinant Rhesus monkey PLAA Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAA Products
Required fields are marked with *
My Review for All PLAA Products
Required fields are marked with *