Recombinant Mouse PLAA Protein (495-584 aa), His-Myc-tagged

• Cat.No.: PLAA-2695M
• Product Overview: Recombinant Mouse PLAA Protein (495-584 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 495-584 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 14.7 kDa
• AA Sequence: TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Plaa phospholipase A2, activating protein [ Mus musculus ]
• Official Symbol: PLAA
• Synonyms: PLAA; PLAP; Ufd3; PLA2P; AI536418; AU018445; AW208417; 2410007N06; D4Ertd618e
• Gene ID: 18786
• mRNA Refseq: NM_172695
• Protein Refseq: NP_766283
• UniProt ID: P27612