Recombinant Mouse PLAA Protein (495-584 aa), His-Myc-tagged

Cat.No. : PLAA-2695M
Product Overview : Recombinant Mouse PLAA Protein (495-584 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 495-584 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 14.7 kDa
AA Sequence : TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Plaa phospholipase A2, activating protein [ Mus musculus ]
Official Symbol PLAA
Synonyms PLAA; PLAP; Ufd3; PLA2P; AI536418; AU018445; AW208417; 2410007N06; D4Ertd618e;
Gene ID 18786
mRNA Refseq NM_172695
Protein Refseq NP_766283
UniProt ID P27612

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLAA Products

Required fields are marked with *

My Review for All PLAA Products

Required fields are marked with *

0
cart-icon