Recombinant Mouse PLBD2 Protein (47-594 aa), His-tagged
Cat.No. : | PLBD2-2164M |
Product Overview : | Recombinant Mouse PLBD2 Protein (47-594 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 47-594 aa |
Description : | Putative phospholipase. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 63.9 kDa |
AA Sequence : | LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Plbd2 phospholipase B domain containing 2 [ Mus musculus (house mouse) ] |
Official Symbol | PLBD2 |
Synonyms | Plbd2; P76; AU019810; 1300012G16Rik; |
Gene ID | 71772 |
mRNA Refseq | NM_023625 |
Protein Refseq | NP_076114 |
UniProt ID | Q3TCN2 |
◆ Recombinant Proteins | ||
PLBD2-4158R | Recombinant Rat PLBD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Plbd2-1327M | Recombinant Mouse Plbd2 Protein, His-tagged | +Inquiry |
PLBD2-084H | Recombinant Human PLBD2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Plbd2-016H | Recombinant Hamster phospholipase B domain containing 2 Protein, His tagged | +Inquiry |
PLBD2-2164M | Recombinant Mouse PLBD2 Protein (47-594 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLBD2-922HCL | Recombinant Human PLBD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLBD2 Products
Required fields are marked with *
My Review for All PLBD2 Products
Required fields are marked with *
0
Inquiry Basket