Recombinant Mouse Pparg protein, His-SUMO-tagged
| Cat.No. : | Pparg-3361M |
| Product Overview : | Recombinant Mouse Pparg protein(P37238)(1-505aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-505aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 73.6 kDa |
| AA Sequence : | MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Pparg peroxisome proliferator activated receptor gamma [ Mus musculus ] |
| Official Symbol | Pparg |
| Synonyms | PPARG; peroxisome proliferator activated receptor gamma; peroxisome proliferator-activated receptor gamma; nuclear receptor subfamily 1 group C member 3; peroxisome proliferator activated receptor gamma 2; peroxisome proliferator activated receptor gamma 4; Nr1c3; PPARgamma; PPAR-gamma; PPARgamma2; PPAR-gamma2; |
| Gene ID | 19016 |
| mRNA Refseq | NM_001127330 |
| Protein Refseq | NP_001120802 |
| ◆ Recombinant Proteins | ||
| PPARG-0777H | Recombinant Human PPARG Protein (P234-Y505), Tag Free | +Inquiry |
| PPARG-3537R | Recombinant Rhesus monkey PPARG Protein, His-tagged | +Inquiry |
| PPARG-67H | Recombinant Human PPARG Protein, His-tagged | +Inquiry |
| Pparg-39M | Recombinant Mouse Pparg protein, His-tagged | +Inquiry |
| PPARG-6969M | Recombinant Mouse PPARG Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPARG-492HCL | Recombinant Human PPARG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pparg Products
Required fields are marked with *
My Review for All Pparg Products
Required fields are marked with *



