Recombinant Mouse Prkab1 Protein, His-tagged

• Cat.No.: Prkab1-4932M
• Product Overview: Recombinant Mouse Prkab1 Protein(Q9R078)(2-270 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 2-270 aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Molecular Mass: 36.1 kDa
• AASequence: GNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKILMDSPEDADIFHSEEIKAPEKEEFLAWQHDLEANDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• protein Refseq-Weblink: http://www.ncbi.nlm.nih.gov/protein/NP_114075.1

Gene Information

• Gene Name: Prkab1 protein kinase, AMP-activated, beta 1 non-catalytic subunit [ Mus musculus ]
• Official Symbol: Prkab1
• Synonyms: PRKAB1; protein kinase, AMP-activated, beta 1 non-catalytic subunit; 5-AMP-activated protein kinase subunit beta-1; AMPKb; AMPK subunit beta-1; AU021155; E430008F22; 1300015D22Rik
• Gene ID: 19079
• mRNA Refseq: NM_031869
• protein Refseq: NP_114075