Recombinant Mouse Prkab1 Protein, His-tagged

Cat.No. : Prkab1-4932M
Product Overview : Recombinant Mouse Prkab1 Protein(Q9R078)(2-270 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 2-270 aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Molecular Mass : 36.1 kDa
AASequence : GNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKILMDSPEDADIFHSEEIKAPEKEEFLAWQHDLEANDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
protein Refseq-Weblink : http://www.ncbi.nlm.nih.gov/protein/NP_114075.1
Gene Name Prkab1 protein kinase, AMP-activated, beta 1 non-catalytic subunit [ Mus musculus ]
Official Symbol Prkab1
Synonyms PRKAB1; protein kinase, AMP-activated, beta 1 non-catalytic subunit; 5-AMP-activated protein kinase subunit beta-1; AMPKb; AMPK subunit beta-1; AU021155; E430008F22; 1300015D22Rik;
Gene ID 19079
mRNA Refseq NM_031869
protein Refseq NP_114075

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Prkab1 Products

Required fields are marked with *

My Review for All Prkab1 Products

Required fields are marked with *

0
cart-icon
0
compare icon