Recombinant Mouse Prkab1 Protein, His-tagged
| Cat.No. : | Prkab1-4932M |
| Product Overview : | Recombinant Mouse Prkab1 Protein(Q9R078)(2-270 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-270 aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Molecular Mass : | 36.1 kDa |
| AASequence : | GNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKILMDSPEDADIFHSEEIKAPEKEEFLAWQHDLEANDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| protein Refseq-Weblink : | http://www.ncbi.nlm.nih.gov/protein/NP_114075.1 |
| Gene Name | Prkab1 protein kinase, AMP-activated, beta 1 non-catalytic subunit [ Mus musculus ] |
| Official Symbol | Prkab1 |
| Synonyms | PRKAB1; protein kinase, AMP-activated, beta 1 non-catalytic subunit; 5-AMP-activated protein kinase subunit beta-1; AMPKb; AMPK subunit beta-1; AU021155; E430008F22; 1300015D22Rik; |
| Gene ID | 19079 |
| mRNA Refseq | NM_031869 |
| protein Refseq | NP_114075 |
| ◆ Recombinant Proteins | ||
| PRKAB1-1945H | Recombinant Human PRKAB1, His-tagged | +Inquiry |
| PRKAB1-3403C | Recombinant Chicken PRKAB1 | +Inquiry |
| PRKAB1-4867H | Recombinant Human Protein Kinase, AMP-Activated, Beta 1 Non-Catalytic Subunit, His-tagged | +Inquiry |
| PRKAB1-1785H | Recombinant Human PRKAB1 protein, His & GST-tagged | +Inquiry |
| Prkab1-4932M | Recombinant Mouse Prkab1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AMPK-412HCL | Recombinant Human AMPK cell lysate | +Inquiry |
| AMPK-410HCL | Recombinant Human AMPK cell lysate | +Inquiry |
| AMPK-411HCL | Recombinant Human AMPK cell lysate | +Inquiry |
| AMPK-416HCL | Recombinant Human AMPK cell lysate | +Inquiry |
| PRKAB1-2869HCL | Recombinant Human PRKAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Prkab1 Products
Required fields are marked with *
My Review for All Prkab1 Products
Required fields are marked with *



