Recombinant Mouse PRL3D1 Protein (30-224 aa), His-tagged
Cat.No. : | PRL3D1-2315M |
Product Overview : | Recombinant Mouse PRL3D1 Protein (30-224 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 30-224 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 26.4 kDa |
AA Sequence : | SKPTAMVPTEDLYTRLAELLHNTFILAADVYREFDLDFFDKTWITDRTLPLCHTASIHTPENREEVHETKTEDLLKAMINVSISWKEPLKHLVSALTALPGASESMGKKAADIKGRNLVILEGLQTIYNRSQANIEENENFDYPAWSGLEELQSPNEDTHLFAVYNLCRCIKRDIHKIDSYIKVLRCRVVFQNEC |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Prl3d1 prolactin family 3, subfamily d, member 1 [ Mus musculus ] |
Official Symbol | PRL3D1 |
Synonyms | PRL3D1; prolactin-3D1; prolactin-like 2; placental lactogen 1; Pl1; Csh1; PL-I; Pl-1; PL-Ia; mPL-I; AI325057; PL-I-alpha; MGC76481; |
Gene ID | 18775 |
mRNA Refseq | NM_001205322 |
Protein Refseq | NP_001192251 |
UniProt ID | P18121 |
◆ Recombinant Proteins | ||
PRL3D1-2315M | Recombinant Mouse PRL3D1 Protein (30-224 aa), His-tagged | +Inquiry |
Prl3d1-1983M | Recombinant Mouse Prl3d1 Protein, His-tagged | +Inquiry |
Prl3d1-1984R | Recombinant Rat Prl3d1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRL3D1 Products
Required fields are marked with *
My Review for All PRL3D1 Products
Required fields are marked with *
0
Inquiry Basket