Recombinant Mouse PRL3D1 Protein (30-224 aa), His-tagged

Cat.No. : PRL3D1-2315M
Product Overview : Recombinant Mouse PRL3D1 Protein (30-224 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 30-224 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 26.4 kDa
AA Sequence : SKPTAMVPTEDLYTRLAELLHNTFILAADVYREFDLDFFDKTWITDRTLPLCHTASIHTPENREEVHETKTEDLLKAMINVSISWKEPLKHLVSALTALPGASESMGKKAADIKGRNLVILEGLQTIYNRSQANIEENENFDYPAWSGLEELQSPNEDTHLFAVYNLCRCIKRDIHKIDSYIKVLRCRVVFQNEC
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Prl3d1 prolactin family 3, subfamily d, member 1 [ Mus musculus ]
Official Symbol PRL3D1
Synonyms PRL3D1; prolactin-3D1; prolactin-like 2; placental lactogen 1; Pl1; Csh1; PL-I; Pl-1; PL-Ia; mPL-I; AI325057; PL-I-alpha; MGC76481;
Gene ID 18775
mRNA Refseq NM_001205322
Protein Refseq NP_001192251
UniProt ID P18121

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRL3D1 Products

Required fields are marked with *

My Review for All PRL3D1 Products

Required fields are marked with *

0
cart-icon