Recombinant Mouse PRL3D1 Protein (30-224 aa), His-tagged

• Cat.No.: PRL3D1-2315M
• Product Overview: Recombinant Mouse PRL3D1 Protein (30-224 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 30-224 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.4 kDa
• AA Sequence: SKPTAMVPTEDLYTRLAELLHNTFILAADVYREFDLDFFDKTWITDRTLPLCHTASIHTPENREEVHETKTEDLLKAMINVSISWKEPLKHLVSALTALPGASESMGKKAADIKGRNLVILEGLQTIYNRSQANIEENENFDYPAWSGLEELQSPNEDTHLFAVYNLCRCIKRDIHKIDSYIKVLRCRVVFQNEC
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Prl3d1 prolactin family 3, subfamily d, member 1 [ Mus musculus ]
• Official Symbol: PRL3D1
• Synonyms: PRL3D1; prolactin-3D1; prolactin-like 2; placental lactogen 1; Pl1; Csh1; PL-I; Pl-1; PL-Ia; mPL-I; AI325057; PL-I-alpha; MGC76481
• Gene ID: 18775
• mRNA Refseq: NM_001205322
• Protein Refseq: NP_001192251
• UniProt ID: P18121