Recombinant Mouse PRND Protein (27-155 aa), His-Myc-tagged

Cat.No. : PRND-2805M
Product Overview : Recombinant Mouse PRND Protein (27-155 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His&Myc
Protein Length : 27-155 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 18.9 kDa
AA Sequence : RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERG
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Prnd prion protein dublet [ Mus musculus ]
Official Symbol PRND
Synonyms PRND; prion protein dublet; prion-like protein doppel; doppelganger; prion protein-like protein; Dpl; PrPLP; doppel; AI450264;
Gene ID 26434
mRNA Refseq NM_001126338
Protein Refseq NP_001119810
UniProt ID Q9QUG3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRND Products

Required fields are marked with *

My Review for All PRND Products

Required fields are marked with *

0
cart-icon
0
compare icon