Recombinant Mouse PRND Protein (27-155 aa), His-Myc-tagged

• Cat.No.: PRND-2805M
• Product Overview: Recombinant Mouse PRND Protein (27-155 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His&Myc
• Protein Length: 27-155 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 18.9 kDa
• AA Sequence: RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERG
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Prnd prion protein dublet [ Mus musculus ]
• Official Symbol: PRND
• Synonyms: PRND; prion protein dublet; prion-like protein doppel; doppelganger; prion protein-like protein; Dpl; PrPLP; doppel; AI450264
• Gene ID: 26434
• mRNA Refseq: NM_001126338
• Protein Refseq: NP_001119810
• UniProt ID: Q9QUG3