Recombinant Human PRND protein, His-tagged
Cat.No. : | PRND-2709H |
Product Overview : | Recombinant Human PRND protein(71-151 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 71-151 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | GAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLER |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | PRND prion protein 2 (dublet) [ Homo sapiens ] |
Official Symbol | PRND |
Synonyms | PRND; prion protein 2 (dublet); prion-like protein doppel; dJ1068H6.4; DOPPEL; DPL; prion like protein doppel; PrPLP; prion gene complex, downstream; MGC41841; |
mRNA Refseq | NM_012409 |
Protein Refseq | NP_036541 |
MIM | 604263 |
UniProt ID | Q9UKY0 |
Gene ID | 23627 |
◆ Recombinant Proteins | ||
PRND-7224H | Recombinant Human PRND, His-tagged | +Inquiry |
PRND-01H | Recombinant Human PRND Protein, His-tagged | +Inquiry |
PRND-2709H | Recombinant Human PRND protein, His-tagged | +Inquiry |
PRND-3434R | Recombinant Rhesus Macaque PRND Protein, His (Fc)-Avi-tagged | +Inquiry |
PRND-5779H | Recombinant Human PRND Protein (Arg27-Gly152), C-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRND Products
Required fields are marked with *
My Review for All PRND Products
Required fields are marked with *