Recombinant Human PRND protein, His-tagged

• Cat.No.: PRND-2709H
• Product Overview: Recombinant Human PRND protein(71-151 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 71-151 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: GAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLER
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: PRND prion protein 2 (dublet) [ Homo sapiens ]
• Official Symbol: PRND
• Synonyms: PRND; prion protein 2 (dublet); prion-like protein doppel; dJ1068H6.4; DOPPEL; DPL; prion like protein doppel; PrPLP; prion gene complex, downstream; MGC41841
• mRNA Refseq: NM_012409
• Protein Refseq: NP_036541
• MIM: 604263
• UniProt ID: Q9UKY0
• Gene ID: 23627