Recombinant Mouse PRSS29 Protein (18-279 aa), His-B2M-tagged
Cat.No. : | PRSS29-1112M |
Product Overview : | Recombinant Mouse PRSS29 Protein (18-279 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 18-279 aa |
Description : | Involved in bryo hatching and implantation. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 43.1 kDa |
AA Sequence : | GTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDAGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Prss29 protease, serine 29 [ Mus musculus (house mouse) ] |
Official Symbol | PRSS29 |
Synonyms | Isp2; D19363; mISP-2; |
Gene ID | 114662 |
mRNA Refseq | NM_053260 |
Protein Refseq | NP_444490 |
UniProt ID | Q99MS4 |
◆ Recombinant Proteins | ||
PRSS29-1112M | Recombinant Mouse PRSS29 Protein (18-279 aa), His-B2M-tagged | +Inquiry |
Prss29-4757M | Recombinant Mouse Prss29 protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRSS29 Products
Required fields are marked with *
My Review for All PRSS29 Products
Required fields are marked with *
0
Inquiry Basket