Recombinant Mouse PRSS29 Protein (18-279 aa), His-B2M-tagged

Cat.No. : PRSS29-1112M
Product Overview : Recombinant Mouse PRSS29 Protein (18-279 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : B2M&His
Protein Length : 18-279 aa
Description : Involved in bryo hatching and implantation.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 43.1 kDa
AA Sequence : GTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDAGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name Prss29 protease, serine 29 [ Mus musculus (house mouse) ]
Official Symbol PRSS29
Synonyms Isp2; D19363; mISP-2;
Gene ID 114662
mRNA Refseq NM_053260
Protein Refseq NP_444490
UniProt ID Q99MS4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRSS29 Products

Required fields are marked with *

My Review for All PRSS29 Products

Required fields are marked with *

0
cart-icon