Recombinant Mouse PSCA Protein (21-95 aa), His-tagged
Cat.No. : | PSCA-1495M |
Product Overview : | Recombinant Mouse PSCA Protein (21-95 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 21-95 aa |
Description : | May be involved in the regulation of cell proliferation. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 10.4 kDa |
AA Sequence : | LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Psca prostate stem cell antigen [ Mus musculus ] |
Official Symbol | PSCA |
Synonyms | PSCA; prostate stem cell antigen; 2210408B04Rik; MGC123434; |
Gene ID | 72373 |
mRNA Refseq | NM_028216 |
Protein Refseq | NP_082492 |
UniProt ID | P57096 |
◆ Cell & Tissue Lysates | ||
PSCA-2791HCL | Recombinant Human PSCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSCA Products
Required fields are marked with *
My Review for All PSCA Products
Required fields are marked with *
0
Inquiry Basket