Recombinant Mouse PSCA Protein (21-95 aa), His-tagged

• Cat.No.: PSCA-1495M
• Product Overview: Recombinant Mouse PSCA Protein (21-95 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 21-95 aa
• Description: May be involved in the regulation of cell proliferation.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 10.4 kDa
• AA Sequence: LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Psca prostate stem cell antigen [ Mus musculus ]
• Official Symbol: PSCA
• Synonyms: PSCA; prostate stem cell antigen; 2210408B04Rik; MGC123434
• Gene ID: 72373
• mRNA Refseq: NM_028216
• Protein Refseq: NP_082492
• UniProt ID: P57096