Recombinant Mouse Ptger4 protein
Cat.No. : | Ptger4-529M |
Product Overview : | Recombinant Mouse Ptger4 protein(P32240)(361-513aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 361-513aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RKTVLSKAIEKIKCLFCRIGGSGRDSSAQHCSESRRTSSAMSGHSRSFLARELKEISSTSQTLLYLPDLTESSLGGRNLLPGSHGMGLTQADTTSLRTLRISETSDSSQGQDSESVLLVDEVSGSHREEPASKGNSLQVTFPSETLKLSEKCI |
Gene Name | Ptger4 prostaglandin E receptor 4 (subtype EP4) [ Mus musculus ] |
Official Symbol | Ptger4 |
Synonyms | PTGER4; prostaglandin E receptor 4 (subtype EP4); prostaglandin E2 receptor EP4 subtype; prostanoid EP4 receptor; PGE receptor EP4 subtype; PGE2 receptor EP4 subtype; prostaglandin E receptor EP4 subtype; prostaglandin E receptor 4 (EP4 subtype); EP4; Ptgerep4; |
Gene ID | 19219 |
mRNA Refseq | NM_001136079 |
Protein Refseq | NP_001129551 |
◆ Recombinant Proteins | ||
RFL23954MF | Recombinant Full Length Mouse Prostaglandin E2 Receptor Ep4 Subtype(Ptger4) Protein, His-Tagged | +Inquiry |
PTGER4-4468R | Recombinant Rat PTGER4 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGER4-1138HFL | Recombinant Human PTGER4 protein, His&Flag-tagged | +Inquiry |
PTGER4-3508R | Recombinant Rhesus Macaque PTGER4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ptger4-5219M | Recombinant Mouse Ptger4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGER4-2716HCL | Recombinant Human PTGER4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ptger4 Products
Required fields are marked with *
My Review for All Ptger4 Products
Required fields are marked with *
0
Inquiry Basket