Recombinant Mouse Rasd1 protein, His-tagged
Cat.No. : | Rasd1-4553M |
Product Overview : | Recombinant Mouse Rasd1 protein(O35626)(1-280aa), fused with N-terminal His tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect cells |
Tag : | His |
Protein Length : | 1-280aa |
Tag : | N-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.2 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVEQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGDHGDAFGILAPFARRPSVHSDLMYIREKTSVGSQAKDKERCVIS |
Gene Name | Rasd1 RAS, dexamethasone-induced 1 [ Mus musculus ] |
Official Symbol | Rasd1 |
Synonyms | RASD1; RAS, dexamethasone-induced 1; dexamethasone-induced Ras-related protein 1; Dexras1; |
Gene ID | 19416 |
mRNA Refseq | NM_009026 |
Protein Refseq | NP_033052 |
◆ Recombinant Proteins | ||
RASD1-4592R | Recombinant Rat RASD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RASD1-3792R | Recombinant Rhesus monkey RASD1 Protein, His-tagged | +Inquiry |
Rasd1-655M | Recombinant Mouse Rasd1 protein, His-tagged | +Inquiry |
RASD1-13946M | Recombinant Mouse RASD1 Protein | +Inquiry |
RASD1-7432M | Recombinant Mouse RASD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASD1-528HCL | Recombinant Human RASD1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rasd1 Products
Required fields are marked with *
My Review for All Rasd1 Products
Required fields are marked with *
0
Inquiry Basket