Recombinant Mouse Reg3g protein, His-tagged
Cat.No. : | Reg3g-3419M |
Product Overview : | Recombinant Mouse Reg3g protein(O09049)(27-174aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-174aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.3 kDa |
AA Sequence : | EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Reg3g regenerating islet-derived 3 gamma [ Mus musculus ] |
Official Symbol | Reg3g |
Synonyms | REG3G; regenerating islet-derived 3 gamma; regenerating islet-derived protein 3-gamma; REG-3-gamma; reg III-gamma; RegIII (gamma); pancreatitis-associated protein 3; regenerating islet-derived protein III-gamma; generating islet-derived, mouse homolog 3 gamma; AI449515; |
Gene ID | 19695 |
mRNA Refseq | NM_011260 |
Protein Refseq | NP_035390 |
◆ Recombinant Proteins | ||
REG3G-4990R | Recombinant Rat REG3G Protein | +Inquiry |
REG3G-5634H | Recombinant Human REG3G Protein (Glu27-Asp175), N-His tagged | +Inquiry |
Reg3g-3420R | Recombinant Rat Reg3g protein, His-tagged | +Inquiry |
REG3G-1502M | Recombinant Mouse REG3G Protein (27-174 aa), His-tagged | +Inquiry |
Reg3g-1284R | Recombinant Rat Reg3g protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG3G-2438HCL | Recombinant Human REG3G cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Reg3g Products
Required fields are marked with *
My Review for All Reg3g Products
Required fields are marked with *