Recombinant Mouse Ren1 Protein, His-tagged

• Cat.No.: Ren1-7315M
• Product Overview: Recombinant Mouse Ren1 protein with a His tag was expressed in insect cells.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His
• Protein Length: 22-402
• Description: Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
• Form: Liquid
• Molecular Mass: 42.5 kDa
• AA Sequence: LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALARHHHHHH
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Ren1 renin 1 structural [ Mus musculus (house mouse) ]
• Official Symbol: Ren1
• Synonyms: Ren1; renin 1 structural; R; Re; Rn; Ren; Rnr; Rn-1; Ren-1; Ren-A; Ren1c; Ren1d; D19352; renin-1; angiotensinogenase; aspartyl-protease; kidney renin; renin b; EC 3.4.23.15
• Gene ID: 19701
• mRNA Refseq: NM_031192
• Protein Refseq: NP_112469
• UniProt ID: P06281