Recombinant Mouse Ren1 Protein, His-tagged

Species :	Mouse
Source :	Insect Cells
Tag :	His
Protein Length :	22-402
Description :	Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
Form :	Liquid
Molecular Mass :	42.5 kDa
AA Sequence :	LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALARHHHHHH
Endotoxin :	< 1.0 EU/μg of protein (determined by LAL method)
Purity :	> 95 % by SDS-PAGE
Stability :	Shelf life: one year from despatch.
Storage :	Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration :	0.25 mg/mL (determined by absorbance at 280nm)
Storage Buffer :	Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.

Gene Name	Ren1 renin 1 structural [ Mus musculus (house mouse) ]
Official Symbol	Ren1
Synonyms	Ren1; renin 1 structural; R; Re; Rn; Ren; Rnr; Rn-1; Ren-1; Ren-A; Ren1c; Ren1d; D19352; renin-1; angiotensinogenase; aspartyl-protease; kidney renin; renin b; EC 3.4.23.15
Gene ID	19701
mRNA Refseq	NM_031192
Protein Refseq	NP_112469
UniProt ID	P06281