Recombinant Mouse Ren1 Protein, His-tagged

Cat.No. : Ren1-7315M
Product Overview : Recombinant Mouse Ren1 protein with a His tag was expressed in insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His
Protein Length : 22-402
Description : Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
Form : Liquid
Molecular Mass : 42.5 kDa
AA Sequence : LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALARHHHHHH
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.
Gene Name Ren1 renin 1 structural [ Mus musculus (house mouse) ]
Official Symbol Ren1
Synonyms Ren1; renin 1 structural; R; Re; Rn; Ren; Rnr; Rn-1; Ren-1; Ren-A; Ren1c; Ren1d; D19352; renin-1; angiotensinogenase; aspartyl-protease; kidney renin; renin b; EC 3.4.23.15
Gene ID 19701
mRNA Refseq NM_031192
Protein Refseq NP_112469
UniProt ID P06281

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ren1 Products

Required fields are marked with *

My Review for All Ren1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon