Recombinant Mouse Ren1 Protein, His-tagged
Cat.No. : | Ren1-7315M |
Product Overview : | Recombinant Mouse Ren1 protein with a His tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 22-402 |
Description : | Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. |
Form : | Liquid |
Molecular Mass : | 42.5 kDa |
AA Sequence : | LPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGVFTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPLIPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLGGSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALARHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.25 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Ren1 renin 1 structural [ Mus musculus (house mouse) ] |
Official Symbol | Ren1 |
Synonyms | Ren1; renin 1 structural; R; Re; Rn; Ren; Rnr; Rn-1; Ren-1; Ren-A; Ren1c; Ren1d; D19352; renin-1; angiotensinogenase; aspartyl-protease; kidney renin; renin b; EC 3.4.23.15 |
Gene ID | 19701 |
mRNA Refseq | NM_031192 |
Protein Refseq | NP_112469 |
UniProt ID | P06281 |
◆ Recombinant Proteins | ||
Ren1-7315M | Recombinant Mouse Ren1 Protein, His-tagged | +Inquiry |
REN1-14072M | Recombinant Mouse REN1 Protein | +Inquiry |
REN1-809M | Recombinant Mouse REN1 Protein | +Inquiry |
Ren1-2305M | Active Recombinant Mouse Ren1 protein, His-tagged | +Inquiry |
Ren1-5461M | Recombinant Mouse Ren1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REN-2576MCL | Recombinant Mouse REN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ren1 Products
Required fields are marked with *
My Review for All Ren1 Products
Required fields are marked with *
0
Inquiry Basket