Recombinant Mouse Retnlb Protein

• Cat.No.: Retnlb-5469M
• Product Overview: Purified recombinant protein of Mouse resistin like beta (Retnlb) without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Probable hormone.
• Molecular Mass: 18 kDa
• AA Sequence: MQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Retnlb resistin like beta [ Mus musculus (house mouse) ]
• Official Symbol: Retnlb
• Synonyms: RETNLB; resistin like beta; resistin-like beta; resistin-like molecule beta; found in inflammatory zone 2; cysteine-rich secreted protein FIZZ2; cysteine-rich secreted protein A12-beta; Xcp3; Fizz2; Relmb; RELMbeta; 9030012B21Rik
• Gene ID: 57263
• mRNA Refseq: NM_023881
• Protein Refseq: NP_076370
• UniProt ID: Q99P86