Recombinant Mouse Retnlb Protein

Cat.No. : Retnlb-5469M
Product Overview : Purified recombinant protein of Mouse resistin like beta (Retnlb) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Probable hormone.
Molecular Mass : 18 kDa
AA Sequence : MQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2
Gene Name Retnlb resistin like beta [ Mus musculus (house mouse) ]
Official Symbol Retnlb
Synonyms RETNLB; resistin like beta; resistin-like beta; resistin-like molecule beta; found in inflammatory zone 2; cysteine-rich secreted protein FIZZ2; cysteine-rich secreted protein A12-beta; Xcp3; Fizz2; Relmb; RELMbeta; 9030012B21Rik
Gene ID 57263
mRNA Refseq NM_023881
Protein Refseq NP_076370
UniProt ID Q99P86

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Retnlb Products

Required fields are marked with *

My Review for All Retnlb Products

Required fields are marked with *

0
cart-icon
0
compare icon