Recombinant Mouse Retnlb Protein
Cat.No. : | Retnlb-5469M |
Product Overview : | Purified recombinant protein of Mouse resistin like beta (Retnlb) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Probable hormone. |
Molecular Mass : | 18 kDa |
AA Sequence : | MQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Retnlb resistin like beta [ Mus musculus (house mouse) ] |
Official Symbol | Retnlb |
Synonyms | RETNLB; resistin like beta; resistin-like beta; resistin-like molecule beta; found in inflammatory zone 2; cysteine-rich secreted protein FIZZ2; cysteine-rich secreted protein A12-beta; Xcp3; Fizz2; Relmb; RELMbeta; 9030012B21Rik |
Gene ID | 57263 |
mRNA Refseq | NM_023881 |
Protein Refseq | NP_076370 |
UniProt ID | Q99P86 |
◆ Recombinant Proteins | ||
RETNLB-50H | Recombinant Human RETNLB | +Inquiry |
Retnlb-1940M | Recombinant Mouse Retnlb protein, His & GST-tagged | +Inquiry |
RETNLB-5569H | Recombinant Human RETNLB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RETNLB-5101H | Recombinant Human RETNLB protein | +Inquiry |
Retnlb-5470M | Recombinant Mouse Retnlb Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RETNLB-2416HCL | Recombinant Human RETNLB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Retnlb Products
Required fields are marked with *
My Review for All Retnlb Products
Required fields are marked with *