Recombinant Mouse Retnlb Protein
Cat.No. : | Retnlb-238M |
Product Overview : | Recombinant Mouse Retnlb Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Resistin-like molecule-beta (RELM-β) is a member of the RELM family of secreted proteins containing conserved C-terminus cysteines. The RELM family consists of Resistin (FIZZ3), RELM-α (FIZZ1), RELM-β (FIZZ2), and RELM-γ (FIZZ4). Resistin and RELM-β are the only RELM family members found in humans, whereas all four RELM family members are present in rodents. RELM-β functions to increase fibroblast proliferation and differentiation, resulting in airway remodelling and increased inflammation. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Homodimer, 8.9/17.8 kDa (83/166 aa) |
AA Sequence : | MQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Retnlb resistin like beta [ Mus musculus (house mouse) ] |
Official Symbol | Retnlb |
Synonyms | RETNLB; resistin like beta; resistin-like beta; resistin-like molecule beta; found in inflammatory zone 2; cysteine-rich secreted protein FIZZ2; cysteine-rich secreted protein A12-beta; Xcp3; Fizz2; Relmb; RELMbeta; 9030012B21Rik; |
Gene ID | 57263 |
mRNA Refseq | NM_023881 |
Protein Refseq | NP_076370 |
UniProt ID | Q99P86 |
◆ Recombinant Proteins | ||
RETNLB-237H | Recombinant Human RETNLB Protein | +Inquiry |
Retnlb-5469M | Recombinant Mouse Retnlb Protein | +Inquiry |
RETNLB-2148HFL | Recombinant Full Length Human RETNLB, Flag-tagged | +Inquiry |
RETNLB-50H | Recombinant Human RETNLB | +Inquiry |
Retnlb-5470M | Recombinant Mouse Retnlb Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RETNLB-2416HCL | Recombinant Human RETNLB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Retnlb Products
Required fields are marked with *
My Review for All Retnlb Products
Required fields are marked with *