Recombinant Mouse Rhox5 protein, GST-tagged
Cat.No. : | Rhox5-301540M |
Product Overview : | Recombinant Mouse Rhox5 (1-106 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Ser106 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MEAEGSSRKVTRLLRLGVKEDSEEQHDVKAEAFFQAGEGRDEQGAQGQPGVGAVGTEGEGEELNGGKGHFGPGAPGPMGDGDKDSGTRAGGVEQEQNEPVAEGTES |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | Rhox5 reproductive homeobox 5 [ Mus musculus ] |
Official Symbol | Rhox5 |
Synonyms | RHOX5; reproductive homeobox 5; homeobox protein Rhox5; homeobox protein Pem; placentae and embryos oncofetal; reproductive homeobox on chromosome X 5; reproductive homeobox on X chromosome, 5; placenta and embryonic expression protein; Pem; AA409564; |
Gene ID | 18617 |
mRNA Refseq | NM_008818 |
Protein Refseq | NP_032844 |
◆ Recombinant Proteins | ||
Rhox5-301540M | Recombinant Mouse Rhox5 protein, GST-tagged | +Inquiry |
RHOX5-4699R | Recombinant Rat RHOX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Rhox5-2297M | Recombinant Mouse Rhox5, GST-tagged | +Inquiry |
RHOX5-5040R | Recombinant Rat RHOX5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Rhox5 Products
Required fields are marked with *
My Review for All Rhox5 Products
Required fields are marked with *
0
Inquiry Basket