Recombinant Mouse S100a1 Protein, His-tagged
| Cat.No. : | S100a1-7317M |
| Product Overview : | Recombinant mouse S100A1 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-94 |
| Description : | Probably acts as a Ca2+ signal transducer. In response to an increase in intracellular Ca2+ levels, binds calcium which triggers a conformational change. This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity. |
| Form : | Liquid |
| Molecular Mass : | 12.6 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS |
| Purity : | > 90 % |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL (determined by Bradford assay) |
| Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 30 % glycerol, 0.1 M NaCl |
| Gene Name | S100a1 S100 calcium binding protein A1 [ Mus musculus (house mouse) ] |
| Official Symbol | S100a1 |
| Synonyms | S100a1; S100 calcium binding protein A1; S10; S100; S100a; AI266795; protein S100-A1; S-100 protein alpha chain; S-100 protein subunit alpha |
| Gene ID | 20193 |
| mRNA Refseq | NM_011309 |
| Protein Refseq | NP_035439 |
| UniProt ID | P56565 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100a1 Products
Required fields are marked with *
My Review for All S100a1 Products
Required fields are marked with *



