Recombinant Mouse S100a1 Protein, His-tagged

• Cat.No.: S100a1-7317M
• Product Overview: Recombinant mouse S100A1 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-94
• Description: Probably acts as a Ca2+ signal transducer. In response to an increase in intracellular Ca2+ levels, binds calcium which triggers a conformational change. This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity.
• Form: Liquid
• Molecular Mass: 12.6 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS
• Purity: > 90 %
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
  Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 30 % glycerol, 0.1 M NaCl

Gene Information

• Gene Name: S100a1 S100 calcium binding protein A1 [ Mus musculus (house mouse) ]
• Official Symbol: S100a1
• Synonyms: S100a1; S100 calcium binding protein A1; S10; S100; S100a; AI266795; protein S100-A1; S-100 protein alpha chain; S-100 protein subunit alpha
• Gene ID: 20193
• mRNA Refseq: NM_011309
• Protein Refseq: NP_035439
• UniProt ID: P56565