Recombinant Mouse S100a8 protein, GST-tagged
| Cat.No. : | S100a8-3464M |
| Product Overview : | Recombinant Mouse S100a8 protein(P27005)(2-89aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 2-89aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.2 kDa |
| AA Sequence : | PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | S100a8 S100 calcium binding protein A8 (calgranulin A) [ Mus musculus ] |
| Official Symbol | S100a8 |
| Synonyms | S100A8; S100 calcium binding protein A8 (calgranulin A); protein S100-A8; MRP-8; calgranulin-A; chemotactic S100 protein; chemotactic cytokine CP-10; pro-inflammatory S100 cytokine; S100 calcium-binding protein A8; leukocyte L1 complex light chain; migration inhibitory factor-related protein 8; p8; B8Ag; CFAg; Caga; MRP8; CP-10; 60B8Ag; AI323541; |
| Gene ID | 20201 |
| mRNA Refseq | NM_013650 |
| Protein Refseq | NP_038678 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100a8 Products
Required fields are marked with *
My Review for All S100a8 Products
Required fields are marked with *



