Recombinant Mouse S100a8 protein, GST-tagged
Cat.No. : | S100a8-3464M |
Product Overview : | Recombinant Mouse S100a8 protein(P27005)(2-89aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-89aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.2 kDa |
AA Sequence : | PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | S100a8 S100 calcium binding protein A8 (calgranulin A) [ Mus musculus ] |
Official Symbol | S100a8 |
Synonyms | S100A8; S100 calcium binding protein A8 (calgranulin A); protein S100-A8; MRP-8; calgranulin-A; chemotactic S100 protein; chemotactic cytokine CP-10; pro-inflammatory S100 cytokine; S100 calcium-binding protein A8; leukocyte L1 complex light chain; migration inhibitory factor-related protein 8; p8; B8Ag; CFAg; Caga; MRP8; CP-10; 60B8Ag; AI323541; |
Gene ID | 20201 |
mRNA Refseq | NM_013650 |
Protein Refseq | NP_038678 |
◆ Recombinant Proteins | ||
S100A8-226H | Recombinant Human S100A8 Protein, MYC/DDK-tagged | +Inquiry |
S100A8-2492H | Recombinant Human S100A8, GST-tagged | +Inquiry |
S100A8/S100A9-13H | Active Recombinant Human S100A8 (Met1-Glu93) and S100A9 (Thr2-Pro114) Heterodimer Protein | +Inquiry |
S100A8-6219H | Recombinant Human S100A8 Protein (Met1-Glu89), C-His tagged | +Inquiry |
S100A8-2216H | Active Recombinant Human S100A8, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A8-685HCL | Recombinant Human S100A8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100a8 Products
Required fields are marked with *
My Review for All S100a8 Products
Required fields are marked with *
0
Inquiry Basket