Recombinant Mouse S100a8 protein, His-SUMO-tagged

Cat.No. : S100a8-3463M
Product Overview : Recombinant Mouse S100a8 protein(P27005)(2-89aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 2-89aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 26.2 kDa
AA Sequence : PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name S100a8 S100 calcium binding protein A8 (calgranulin A) [ Mus musculus ]
Official Symbol S100a8
Synonyms S100A8; S100 calcium binding protein A8 (calgranulin A); protein S100-A8; MRP-8; calgranulin-A; chemotactic S100 protein; chemotactic cytokine CP-10; pro-inflammatory S100 cytokine; S100 calcium-binding protein A8; leukocyte L1 complex light chain; migration inhibitory factor-related protein 8; p8; B8Ag; CFAg; Caga; MRP8; CP-10; 60B8Ag; AI323541;
Gene ID 20201
mRNA Refseq NM_013650
Protein Refseq NP_038678

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100a8 Products

Required fields are marked with *

My Review for All S100a8 Products

Required fields are marked with *

0
cart-icon