Recombinant Mouse S100a8 protein, His-SUMO-tagged

• Cat.No.: S100a8-3463M
• Product Overview: Recombinant Mouse S100a8 protein(P27005)(2-89aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 2-89aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.2 kDa
• AA Sequence: PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: S100a8 S100 calcium binding protein A8 (calgranulin A) [ Mus musculus ]
• Official Symbol: S100a8
• Synonyms: S100A8; S100 calcium binding protein A8 (calgranulin A); protein S100-A8; MRP-8; calgranulin-A; chemotactic S100 protein; chemotactic cytokine CP-10; pro-inflammatory S100 cytokine; S100 calcium-binding protein A8; leukocyte L1 complex light chain; migration inhibitory factor-related protein 8; p8; B8Ag; CFAg; Caga; MRP8; CP-10; 60B8Ag; AI323541
• Gene ID: 20201
• mRNA Refseq: NM_013650
• Protein Refseq: NP_038678