Recombinant Mouse S100b Protein, His-tagged
Cat.No. : | S100b-7332M |
Product Overview : | Recombinant mouse S100B protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-92 |
Description : | Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity. |
Form : | Liquid |
Molecular Mass : | 12.8 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE |
Purity : | > 85 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 10 % glycerol |
Gene Name | S100b S100 protein, beta polypeptide, neural [ Mus musculus (house mouse) ] |
Official Symbol | S100b |
Synonyms | S100b; S100 protein, beta polypeptide, neural; Bpb; AI850290; protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B |
Gene ID | 20203 |
mRNA Refseq | NM_009115 |
Protein Refseq | NP_033141 |
UniProt ID | P50114 |
◆ Recombinant Proteins | ||
S100b-2571M | Recombinant Mouse S100b, His-tagged | +Inquiry |
S100B-1703C | Recombinant Canine S100B protein, hFc-tagged | +Inquiry |
S100B-68H | Active Recombinant Human S100B protein(Ser2-Glu92), hFc-tagged | +Inquiry |
S100B-2542H | Recombinant Human S100B protein(11-80 aa), C-His-tagged | +Inquiry |
S100b-566R | Recombinant Rat S100b protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
S100B-1116H | Native Human S100B Protein | +Inquiry |
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100B-1418MCL | Recombinant Mouse S100B cell lysate | +Inquiry |
S100B-2858HCL | Recombinant Human S100B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100b Products
Required fields are marked with *
My Review for All S100b Products
Required fields are marked with *