Recombinant Mouse S100b Protein, His-tagged

• Cat.No.: S100b-7332M
• Product Overview: Recombinant mouse S100B protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-92
• Description: Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.
• Form: Liquid
• Molecular Mass: 12.8 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE
• Purity: > 85 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
  Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 10 % glycerol

Gene Information

• Gene Name: S100b S100 protein, beta polypeptide, neural [ Mus musculus (house mouse) ]
• Official Symbol: S100b
• Synonyms: S100b; S100 protein, beta polypeptide, neural; Bpb; AI850290; protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B
• Gene ID: 20203
• mRNA Refseq: NM_009115
• Protein Refseq: NP_033141
• UniProt ID: P50114