Recombinant Mouse Saa4 protein(19-130aa), His-tagged
Cat.No. : | Saa4-3920M |
Product Overview : | Recombinant Mouse Saa4 protein(P31532)(19-130aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-130aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.2 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | DGWYSFFREAVQGTWDLWRAYRDNLEANYQNADQYFYARGNYEAQQRGSGGIWAAKIISTSRKYFQGLLNRYYFGIRNHGLETLQATQKAEEWGRSGKNPNHFRPEGLPEKF |
Gene Name | Saa4 serum amyloid A 4 [ Mus musculus ] |
Official Symbol | Saa4 |
Synonyms | SAA4; serum amyloid A 4; serum amyloid A-4 protein; amyloid A-5 protein; Saa-4; Saa-5; |
Gene ID | 20211 |
mRNA Refseq | NM_011316 |
Protein Refseq | NP_035446 |
◆ Recombinant Proteins | ||
SAA4-6234H | Recombinant Human SAA4 Protein | +Inquiry |
SAA4-2498H | Recombinant Human SAA4 protein, His-TRxA-tagged | +Inquiry |
SAA4-7314H | Recombinant Human SAA4 protein(Glu19-Tyr130), GST-tagged | +Inquiry |
Saa4-3920M | Recombinant Mouse Saa4 protein(19-130aa), His-tagged | +Inquiry |
SAA4-6235H | Recombinant Human SAA4 Protein (Glu19-Thr130), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAA4-2078HCL | Recombinant Human SAA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Saa4 Products
Required fields are marked with *
My Review for All Saa4 Products
Required fields are marked with *
0
Inquiry Basket