Recombinant Mouse Saa4 protein(19-130aa), His-tagged

• Cat.No.: Saa4-3920M
• Product Overview: Recombinant Mouse Saa4 protein(P31532)(19-130aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 19-130aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: DGWYSFFREAVQGTWDLWRAYRDNLEANYQNADQYFYARGNYEAQQRGSGGIWAAKIISTSRKYFQGLLNRYYFGIRNHGLETLQATQKAEEWGRSGKNPNHFRPEGLPEKF

Gene Information

• Gene Name: Saa4 serum amyloid A 4 [ Mus musculus ]
• Official Symbol: Saa4
• Synonyms: SAA4; serum amyloid A 4; serum amyloid A-4 protein; amyloid A-5 protein; Saa-4; Saa-5
• Gene ID: 20211
• mRNA Refseq: NM_011316
• Protein Refseq: NP_035446