Recombinant Mouse Scgb1a1 protein

Cat.No. : Scgb1a1-1396M
Product Overview : Recombinant Mouse Scgb1a1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 75
Description : This gene encodes a member of the secretoglobin family of small secreted proteins. The encoded protein has been implicated in numerous functions including anti-inflammation, inhibition of phospholipase A2 and the sequestering of hydrophobic ligands. Defects in this gene are associated with a susceptibility to asthma.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by the ability of the immobilized protein to support the adhesion of the A549 human lung carcinoma cells is less than 5.0 μg/ml, corresponding to a specific activity of > 200 IU/mg.
Molecular Mass : Approximately 16.7 kDa, a disulfide-linked homodimeric protein containing two 75 amino acid residues polypeptide.
AA Sequence : DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF
Endotoxin : Less than 0.1 EU/µg of rMuUteroglobin as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Scgb1a1
Official Symbol Scgb1a1
Synonyms SCGB1A1; secretoglobin, family 1A, member 1 (uteroglobin); uteroglobin; CCPBP; Blastokinin; PCB-binding protein; clara cell 17 kDa protein; clara cell secretory protein; secretoglobin family 1A member 1; clara cells 10 kDa secretory protein; clara cell phospholipid-binding protein; UG; UGB; Utg; CC10; CC16; CCSP; PCB-BP;
Gene ID 22287
mRNA Refseq NM_011681
Protein Refseq NP_035811
UniProt ID Q06318

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Scgb1a1 Products

Required fields are marked with *

My Review for All Scgb1a1 Products

Required fields are marked with *

0
cart-icon