Recombinant Mouse SCGB1C1 Protein (24-95 aa), His-SUMO-tagged
| Cat.No. : | SCGB1C1-2680M |
| Product Overview : | Recombinant Mouse SCGB1C1 Protein (24-95 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 24-95 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 21.2 kDa |
| AA Sequence : | EDDNEFFMEFLQTLLVGTPEELYEGPLGKYNVNDMAKSALRELKSCIDELQPVHKEQLVKLLVQVLDAQEDT |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Scgb1c1 secretoglobin, family 1C, member 1 [ Mus musculus (house mouse) ] |
| Official Symbol | SCGB1C1 |
| Synonyms | Scgb1c1; Ryd5; |
| Gene ID | 338417 |
| UniProt ID | Q7M742 |
| ◆ Recombinant Proteins | ||
| SCGB1C1-4093R | Recombinant Rhesus monkey SCGB1C1 Protein, His-tagged | +Inquiry |
| SCGB1C1-2680M | Recombinant Mouse SCGB1C1 Protein (24-95 aa), His-SUMO-tagged | +Inquiry |
| SCGB1C1-3910R | Recombinant Rhesus Macaque SCGB1C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Scgb1c1-5711M | Recombinant Mouse Scgb1c1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCGB1C1-2039HCL | Recombinant Human SCGB1C1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCGB1C1 Products
Required fields are marked with *
My Review for All SCGB1C1 Products
Required fields are marked with *
