Recombinant Mouse SCGB1C1 Protein (24-95 aa), His-SUMO-tagged

Cat.No. : SCGB1C1-2680M
Product Overview : Recombinant Mouse SCGB1C1 Protein (24-95 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 24-95 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 21.2 kDa
AA Sequence : EDDNEFFMEFLQTLLVGTPEELYEGPLGKYNVNDMAKSALRELKSCIDELQPVHKEQLVKLLVQVLDAQEDT
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Scgb1c1 secretoglobin, family 1C, member 1 [ Mus musculus (house mouse) ]
Official Symbol SCGB1C1
Synonyms Scgb1c1; Ryd5;
Gene ID 338417
UniProt ID Q7M742

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCGB1C1 Products

Required fields are marked with *

My Review for All SCGB1C1 Products

Required fields are marked with *

0
cart-icon