Recombinant Mouse SDF2L1 Protein (29-211 aa), His-Myc-tagged
Cat.No. : | SDF2L1-2080M |
Product Overview : | Recombinant Mouse SDF2L1 Protein (29-211 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 29-211 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.4 kDa |
AA Sequence : | SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Sdf2l1 stromal cell-derived factor 2-like 1 [ Mus musculus ] |
Official Symbol | SDF2L1 |
Synonyms | SDF2L1; stromal cell-derived factor 2-like 1; SDF2-like protein 1; |
Gene ID | 64136 |
mRNA Refseq | NM_022324 |
Protein Refseq | NP_071719 |
UniProt ID | Q9ESP1 |
◆ Recombinant Proteins | ||
SDF2L1-4109R | Recombinant Rhesus monkey SDF2L1 Protein, His-tagged | +Inquiry |
SDF2L1-2080M | Recombinant Mouse SDF2L1 Protein (29-211 aa), His-Myc-tagged | +Inquiry |
SDF2L1-2553H | Recombinant Human SDF2L1, His-tagged | +Inquiry |
SDF2L1-7964M | Recombinant Mouse SDF2L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SDF2L1-14799M | Recombinant Mouse SDF2L1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDF2L1-2012HCL | Recombinant Human SDF2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDF2L1 Products
Required fields are marked with *
My Review for All SDF2L1 Products
Required fields are marked with *
0
Inquiry Basket