Recombinant Mouse SDF2L1 Protein (29-211 aa), His-Myc-tagged
| Cat.No. : | SDF2L1-2080M |
| Product Overview : | Recombinant Mouse SDF2L1 Protein (29-211 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His&Myc |
| Protein Length : | 29-211 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 24.4 kDa |
| AA Sequence : | SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Sdf2l1 stromal cell-derived factor 2-like 1 [ Mus musculus ] |
| Official Symbol | SDF2L1 |
| Synonyms | SDF2L1; stromal cell-derived factor 2-like 1; SDF2-like protein 1; |
| Gene ID | 64136 |
| mRNA Refseq | NM_022324 |
| Protein Refseq | NP_071719 |
| UniProt ID | Q9ESP1 |
| ◆ Recombinant Proteins | ||
| SDF2L1-2080M | Recombinant Mouse SDF2L1 Protein (29-211 aa), His-Myc-tagged | +Inquiry |
| SDF2L1-1073Z | Recombinant Zebrafish SDF2L1 | +Inquiry |
| SDF2L1-3926R | Recombinant Rhesus Macaque SDF2L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SDF2L1-5782H | Recombinant Human SDF2L1 Protein (Ala29-Glu213), N-His tagged | +Inquiry |
| Sdf2l1-7913M | Recombinant Mouse Sdf2l1 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SDF2L1-2012HCL | Recombinant Human SDF2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDF2L1 Products
Required fields are marked with *
My Review for All SDF2L1 Products
Required fields are marked with *




