Recombinant Mouse SDF2L1 Protein (29-211 aa), His-Myc-tagged

Cat.No. : SDF2L1-2080M
Product Overview : Recombinant Mouse SDF2L1 Protein (29-211 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His&Myc
Protein Length : 29-211 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 24.4 kDa
AA Sequence : SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Sdf2l1 stromal cell-derived factor 2-like 1 [ Mus musculus ]
Official Symbol SDF2L1
Synonyms SDF2L1; stromal cell-derived factor 2-like 1; SDF2-like protein 1;
Gene ID 64136
mRNA Refseq NM_022324
Protein Refseq NP_071719
UniProt ID Q9ESP1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SDF2L1 Products

Required fields are marked with *

My Review for All SDF2L1 Products

Required fields are marked with *

0
cart-icon
0
compare icon