Recombinant Mouse Serpinb5 protein, Avi-tagged, Biotinylated

Cat.No. : Serpinb5-5082M
Product Overview : Biotinylated Recombinant Mouse Serpinb5 protein(P70124)(1-375 aa), fused with Avi tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Avi
Protein Length : 1-375 aa
Conjugation/Label : Biotin
Form : Tris/PBS-based buffer, 6% Trehalose.
AASequence : MDALRLANSAFAVDLFKQLCERDPAGNILFSPICLSTSLSLAQVGTKGDTANEIGQVLHF ENVKDVPFGFQTVTSDVNKLSSFYSLKLVKRLYIDKSLNPSTEFISSTKRPYAKELETVD FKDKLEETKGQINSSIKELTDGHFEDILSENSISDQTKILVVNAAYFVGKWMKKFPESET KECPFRISKTDTKPVQMMNLEATFCLGNIDDISCKIIELPFQNKHLSMLIVLPKDVEDES TGLEKIEQQLNPETLLQWTNPSTMANAKVKLSLPKFKVEKMIDPKASLESLGLKSLFNES TSDFSGMSETKGVSLSNVIHRVCLEITEDGGESIEVPGSRILQHKDEFNADHPFIYIIRH NKTRNIIFFGKFCSP
Purity : >85% (SDS-PAGE)
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. 
Conjugation : Biotin
Gene Name Serpinb5 serine (or cysteine) peptidase inhibitor, clade B, member 5 [ Mus musculus ]
Official Symbol Serpinb5
Synonyms SERPINB5; serine (or cysteine) peptidase inhibitor, clade B, member 5; serpin B5; protease inhibitor 5; peptidase inhibitor 5; serine protease inhibitor 7; serine (or cysteine) proteinase inhibitor, clade B, member 5; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 5; PI-5; Spi7; Maspin; AI462524; AI646751; ovalbumin; 1110036M19Rik;
Gene ID 20724
mRNA Refseq NM_009257
Protein Refseq NP_033283

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Serpinb5 Products

Required fields are marked with *

My Review for All Serpinb5 Products

Required fields are marked with *

0
cart-icon