Recombinant Full Length Mouse SIAE Protein, His tagged

Cat.No. : SIAE-15119M
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 22-541 aa
Description : Predicted to enable sialate O-acetylesterase activity. Predicted to be involved in carbohydrate metabolic process and regulation of immune system process. Located in lysosome. Is expressed in several structures, including abdominal fat pad; central nervous system; genitourinary system; immune system; and yolk sac. Human ortholog(s) of this gene implicated in autoimmune disease. Orthologous to human SIAE (sialic acid acetylesterase).
Molecular Mass : 60 kDa
AA Sequence : AGIGFRFASYIDNYMVLQKEPSGAVIWGFGTPGATVTVTLCQGQETIMKKVTSVKEPSNTWMVVLDPMKPGGPFEVMAQQTLGTMNFTLRVHDVLFGDVWLCSGQSNMQMTVSQIFNASKELSDTAAYQSVRIFSVSLIQSEEELDDLTEVDLSWSKPTAGNLGHGNFTYMSAVCWLFGRYLYDTLQYPIGLVSSSWGGTYIEVWSSRRTLKACGVPNTRDERVGQPEIKPMRNECNSEESSCPFRVVPSVRVTGPTRHSVLWNAMIHPLQNMTLKGVVWYQGESNADYNRDLYTCMFPELIEDWRQTFHYGSQGQTDRFFPFGFVQLSSYMLKNSSDYGFPEIRWHQTADFGHVPNPKMPNTFMAVAIDLCDRDSPFGSIHPRDKQTVAYRLHLGARAVAYGEKNLTFQGPLPKKIELLASNGLLNLTYDQEIQVQMQDNKTFEISCCSDRHCKWLPAPVNTFSTQTLILDLNACLGTVVAVRYAWTTWPCEYKQCAVYHTSSMLPAPPFIAQISHRGIHHHHHHHH
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 0.22 mg/mL by BCA
Publications :
Pregnancy enables antibody protection against intracellular infection (2022)
Gene Name Siae sialic acid acetylesterase [ Mus musculus (house mouse) ]
Official Symbol SIAE
Synonyms SIAE; sialic acid acetylesterase; sialate O-acetylesterase; clone 165; yolk sac gene 2; yolk sac protein 2; sialic acid-specific 9-O-acetylesterase; LSE; Ysg2
Gene ID 22619
mRNA Refseq NM_011734
Protein Refseq NP_035864
UniProt ID P70665

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Siae Products

Required fields are marked with *

My Review for All Siae Products

Required fields are marked with *

0

Inquiry Basket

cartIcon