Recombinant Mouse SIGIRR Protein (1-117 aa), His-tagged

• Cat.No.: SIGIRR-2054M
• Product Overview: Recombinant Mouse SIGIRR Protein (1-117 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 1-117 aa
• Description: Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its Extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity).
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 14.7 kDa
• AA Sequence: MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Sigirr single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Mus musculus ]
• Official Symbol: SIGIRR
• Synonyms: SIGIRR; toll/interleukin-1 receptor 8; TIR8; AI256711; MGC102426
• Gene ID: 24058
• mRNA Refseq: NM_023059
• Protein Refseq: NP_075546
• UniProt ID: Q9JLZ8