Recombinant Mouse SIGIRR Protein (1-117 aa), His-tagged
Cat.No. : | SIGIRR-2054M |
Product Overview : | Recombinant Mouse SIGIRR Protein (1-117 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-117 aa |
Description : | Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its Extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 14.7 kDa |
AA Sequence : | MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Sigirr single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Mus musculus ] |
Official Symbol | SIGIRR |
Synonyms | SIGIRR; toll/interleukin-1 receptor 8; TIR8; AI256711; MGC102426; |
Gene ID | 24058 |
mRNA Refseq | NM_023059 |
Protein Refseq | NP_075546 |
UniProt ID | Q9JLZ8 |
◆ Recombinant Proteins | ||
SIGIRR-4659H | Recombinant Human SIGIRR protein, His-tagged | +Inquiry |
SIGIRR-2054M | Recombinant Mouse SIGIRR Protein (1-117 aa), His-tagged | +Inquiry |
SIGIRR-5400R | Recombinant Rat SIGIRR Protein | +Inquiry |
Sigirr-1952R | Recombinant Rat Sigirr protein, His-tagged | +Inquiry |
SIGIRR-1950H | Recombinant Human SIGIRR protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIGIRR-2773MCL | Recombinant Mouse SIGIRR cell lysate | +Inquiry |
SIGIRR-1091HCL | Recombinant Human SIGIRR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIGIRR Products
Required fields are marked with *
My Review for All SIGIRR Products
Required fields are marked with *