Recombinant Mouse SIGIRR Protein (1-117 aa), His-tagged
| Cat.No. : | SIGIRR-2054M |
| Product Overview : | Recombinant Mouse SIGIRR Protein (1-117 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-117 aa |
| Description : | Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its Extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity). |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 14.7 kDa |
| AA Sequence : | MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Sigirr single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Mus musculus ] |
| Official Symbol | SIGIRR |
| Synonyms | SIGIRR; toll/interleukin-1 receptor 8; TIR8; AI256711; MGC102426; |
| Gene ID | 24058 |
| mRNA Refseq | NM_023059 |
| Protein Refseq | NP_075546 |
| UniProt ID | Q9JLZ8 |
| ◆ Recombinant Proteins | ||
| SIGIRR-6152H | Recombinant Human SIGIRR Protein (Met1-His118), His tagged | +Inquiry |
| SIGIRR-2708H | Recombinant Human SIGIRR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SIGIRR-4376C | Recombinant Chicken SIGIRR | +Inquiry |
| SIGIRR-4483H | Recombinant Human SIGIRR Protein, His (Fc)-Avi-tagged | +Inquiry |
| Sigirr-1951M | Recombinant Mouse Sigirr protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIGIRR-2773MCL | Recombinant Mouse SIGIRR cell lysate | +Inquiry |
| SIGIRR-1091HCL | Recombinant Human SIGIRR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIGIRR Products
Required fields are marked with *
My Review for All SIGIRR Products
Required fields are marked with *
