Recombinant Mouse GJA1 protein, His-tagged

Cat.No. : GJA1-893M
Product Overview : Recombinant Mouse GJA1 protein is produced by E. coli expression system. This protein is fused with a His tag at the N-terminal.
Availability July 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : Ser180-Ile382
Form : 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Molecular Mass : 26 kDa
AA Sequence : SLSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDSQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
Endotoxin : <1.0EU per 1µg (determined by the LAL method)
Purity : > 97%
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Reconstitution : Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name Gja1 gap junction protein, alpha 1 [ Mus musculus ]
Official Symbol GJA1
Synonyms GJA1; gap junction protein, alpha 1; connexin 43; connexin-43; alpha 1 connexin; Cx43; Npm1; Cnx43; Gja-1; AU042049; AW546267; Cx43alpha1; connexin43;
Gene ID 14609
mRNA Refseq NM_010288
Protein Refseq NP_034418

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GJA1 Products

Required fields are marked with *

My Review for All GJA1 Products

Required fields are marked with *

0
cart-icon