Recombinant Mouse Sod2 Protein, His-tagged

Cat.No. : Sod2-7342M
Product Overview : Recombinant mouse Sod2, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 25-222
Description : Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
Form : Liquid
Molecular Mass : 24.6 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNATEEKYHEALAKGDVTTQVALQPALKFNGGGHINHTIFWTNLSPKGGGEPKGELLEAIKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYTACKK
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by bradford assay)
Storage Buffer : In Phosphate buffered saline (pH7.4) containing 10 % glycerol, 1 mM DTT.
Gene Name Sod2 superoxide dismutase 2, mitochondrial [ Mus musculus (house mouse) ]
Official Symbol Sod2
Synonyms Sod2; superoxide dismutase 2, mitochondrial; Mn; Sod; MnSOD; Sod-2; superoxide dismutase [Mn], mitochondrial; manganese SOD; manganese superoxide dismutase; EC 1.15.1.1
Gene ID 20656
mRNA Refseq NM_013671
Protein Refseq NP_038699
UniProt ID P09671

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Sod2 Products

Required fields are marked with *

My Review for All Sod2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon