Recombinant Mouse Sod2 Protein, His-tagged

• Cat.No.: Sod2-7342M
• Product Overview: Recombinant mouse Sod2, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 25-222
• Description: Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
• Form: Liquid
• Molecular Mass: 24.6 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNATEEKYHEALAKGDVTTQVALQPALKFNGGGHINHTIFWTNLSPKGGGEPKGELLEAIKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYTACKK
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by bradford assay)
• Storage Buffer: In Phosphate buffered saline (pH7.4) containing 10 % glycerol, 1 mM DTT.

Gene Information

• Gene Name: Sod2 superoxide dismutase 2, mitochondrial [ Mus musculus (house mouse) ]
• Official Symbol: Sod2
• Synonyms: Sod2; superoxide dismutase 2, mitochondrial; Mn; Sod; MnSOD; Sod-2; superoxide dismutase [Mn], mitochondrial; manganese SOD; manganese superoxide dismutase; EC 1.15.1.1
• Gene ID: 20656
• mRNA Refseq: NM_013671
• Protein Refseq: NP_038699
• UniProt ID: P09671