Recombinant Mouse Sod2 Protein, His-tagged
Cat.No. : | Sod2-7342M |
Product Overview : | Recombinant mouse Sod2, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-222 |
Description : | Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems. |
Form : | Liquid |
Molecular Mass : | 24.6 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNATEEKYHEALAKGDVTTQVALQPALKFNGGGHINHTIFWTNLSPKGGGEPKGELLEAIKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYTACKK |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by bradford assay) |
Storage Buffer : | In Phosphate buffered saline (pH7.4) containing 10 % glycerol, 1 mM DTT. |
Gene Name | Sod2 superoxide dismutase 2, mitochondrial [ Mus musculus (house mouse) ] |
Official Symbol | Sod2 |
Synonyms | Sod2; superoxide dismutase 2, mitochondrial; Mn; Sod; MnSOD; Sod-2; superoxide dismutase [Mn], mitochondrial; manganese SOD; manganese superoxide dismutase; EC 1.15.1.1 |
Gene ID | 20656 |
mRNA Refseq | NM_013671 |
Protein Refseq | NP_038699 |
UniProt ID | P09671 |
◆ Recombinant Proteins | ||
SOD2-1039H | Recombinant Human SOD2 | +Inquiry |
Sod2-7342M | Recombinant Mouse Sod2 Protein, His-tagged | +Inquiry |
SOD2-5785C | Recombinant Chicken SOD2 | +Inquiry |
SOD2-2681H | Recombinant Human SOD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SOD2-1636H | Recombinant Human Superoxide Dismutase 2, Mitochondrial, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOD2-1574HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
SOD2-1575HCL | Recombinant Human SOD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sod2 Products
Required fields are marked with *
My Review for All Sod2 Products
Required fields are marked with *
0
Inquiry Basket