Recombinant Mouse Sord protein, His-tagged
Cat.No. : | Sord-4561M |
Product Overview : | Recombinant Mouse Sord protein(Q64442)(2-357 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-357 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 45.0 kDa |
AASequence : | AAPAKGENLSLVVHGPGDIRLENYPIPELGPNDVLLKMHSVGICGSDVHYWEHGRIGDFVVKKPMVLGHEAAGTVTKVGELVKHLKPGDRVAIEPGVPREVDEYCKIGRYNLTPTIFFCATPPDDGNLCRFYKHNADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGNKVLVCGAGPVGMVTLLVAKAMGAAQVVVTDLSASRLTKAKEVGADFTIQVGKETPQEIASKVESLLGSKPEVTIECTGAESSVQTGIYATHSGGTLVIVGMGAEMVNLPLVHAAIREVDIKGVFRYCNTWPMAISMLASKTLNVKPLVTHRFPLEKAVEAFETAKKGVGLKVMIKCDPNDQNP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | Sord sorbitol dehydrogenase [ Mus musculus ] |
Official Symbol | Sord |
Synonyms | SORD; sorbitol dehydrogenase; L-iditol 2-dehydrogenase; sorbitol dehydrogenase 1; Sdh1; Sdh-1; Sodh-1; MGC31355; |
Gene ID | 20322 |
mRNA Refseq | NM_146126 |
Protein Refseq | NP_666238 |
◆ Recombinant Proteins | ||
SORD-30012TH | Recombinant Human SORD, His-tagged | +Inquiry |
SORD-4224R | Recombinant Rhesus Macaque SORD Protein, His (Fc)-Avi-tagged | +Inquiry |
SORD-6335H | Recombinant Human SORD Protein (Ala98-Gln355), N-His tagged | +Inquiry |
SORD-2878H | Recombinant Human SORD, His-tagged | +Inquiry |
SORD-5544C | Recombinant Chicken SORD | +Inquiry |
◆ Cell & Tissue Lysates | ||
SORD-1569HCL | Recombinant Human SORD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sord Products
Required fields are marked with *
My Review for All Sord Products
Required fields are marked with *