Recombinant Mouse Sord protein, His-tagged
| Cat.No. : | Sord-4561M |
| Product Overview : | Recombinant Mouse Sord protein(Q64442)(2-357 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-357 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 45.0 kDa |
| AASequence : | AAPAKGENLSLVVHGPGDIRLENYPIPELGPNDVLLKMHSVGICGSDVHYWEHGRIGDFVVKKPMVLGHEAAGTVTKVGELVKHLKPGDRVAIEPGVPREVDEYCKIGRYNLTPTIFFCATPPDDGNLCRFYKHNADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGNKVLVCGAGPVGMVTLLVAKAMGAAQVVVTDLSASRLTKAKEVGADFTIQVGKETPQEIASKVESLLGSKPEVTIECTGAESSVQTGIYATHSGGTLVIVGMGAEMVNLPLVHAAIREVDIKGVFRYCNTWPMAISMLASKTLNVKPLVTHRFPLEKAVEAFETAKKGVGLKVMIKCDPNDQNP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | Sord sorbitol dehydrogenase [ Mus musculus ] |
| Official Symbol | Sord |
| Synonyms | SORD; sorbitol dehydrogenase; L-iditol 2-dehydrogenase; sorbitol dehydrogenase 1; Sdh1; Sdh-1; Sodh-1; MGC31355; |
| Gene ID | 20322 |
| mRNA Refseq | NM_146126 |
| Protein Refseq | NP_666238 |
| ◆ Recombinant Proteins | ||
| SORD-6334H | Recombinant Human SORD Protein (Ala2-Pro357), C-His tagged | +Inquiry |
| SORD-5389H | Recombinant Human SORD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SORD-29H | Active Recombinant Human SORD Protein | +Inquiry |
| SORD-5330R | Recombinant Rat SORD Protein, His (Fc)-Avi-tagged | +Inquiry |
| SORD-4408R | Recombinant Rhesus monkey SORD Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SORD-1569HCL | Recombinant Human SORD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sord Products
Required fields are marked with *
My Review for All Sord Products
Required fields are marked with *
