Recombinant Mouse Sost protein, hFc-tagged

• Cat.No.: Sost-4566M
• Product Overview: Recombinant Mouse Sost protein(Q99P68)(24-211aa), fused to C-terminal hFc tag, was expressed in Mammalian cell.

Specification

• Species: Mouse
• Source: Mammalian Cells
• Tag: Fc
• Protein Length: 24-211aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 50.1 kDa
• AA Sequence: QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Sost sclerostin [ Mus musculus ]
• Official Symbol: Sost
• Synonyms: SOST; sclerostin; 5430411E23Rik
• Gene ID: 74499
• mRNA Refseq: NM_024449
• Protein Refseq: NP_077769