Recombinant Rat Sost protein, hFc-tagged
| Cat.No. : | Sost-4567R |
| Product Overview : | Recombinant Rat Sost protein(Q99P67)(29-213aa), fused to C-terminal hFc tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | Mammalian Cells |
| Tag : | Fc |
| Protein Length : | 29-213aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 50 kDa |
| AA Sequence : | FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Sost sclerostin [ Rattus norvegicus ] |
| Official Symbol | Sost |
| Synonyms | SOST; sclerostin; sclerosteosis; |
| Gene ID | 80722 |
| mRNA Refseq | NM_030584 |
| Protein Refseq | NP_085073 |
| ◆ Recombinant Proteins | ||
| SOST-5673R | Recombinant Rat SOST Protein | +Inquiry |
| SOST-4226R | Recombinant Rhesus Macaque SOST Protein, His (Fc)-Avi-tagged | +Inquiry |
| SOST-5332R | Recombinant Rat SOST Protein, His (Fc)-Avi-tagged | +Inquiry |
| Sost-753M | Recombinant Mouse Sost protein, His-tagged | +Inquiry |
| SOST-4106H | Recombinant Human SOST Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOST-2251RCL | Recombinant Rat SOST cell lysate | +Inquiry |
| SOST-2846HCL | Recombinant Human SOST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sost Products
Required fields are marked with *
My Review for All Sost Products
Required fields are marked with *
