Recombinant Mouse SPINK1 Protein (24-80 aa), His-tagged
Cat.No. : | SPINK1-1623M |
Product Overview : | Recombinant Mouse SPINK1 Protein (24-80 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-80 aa |
Description : | Serine protease inhibitor which exhibits anti-trypsin activity. Inhibits the uptake of calcium by spermatozoa. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 8.1 kDa |
AA Sequence : | AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Spink1 serine peptidase inhibitor, Kazal type 1 [ Mus musculus (house mouse) ] |
Official Symbol | SPINK1 |
Synonyms | p12; Spink3; |
Gene ID | 20730 |
mRNA Refseq | NM_009258 |
Protein Refseq | NP_033284 |
UniProt ID | P09036 |
◆ Recombinant Proteins | ||
SPINK1-6344H | Recombinant Human SPINK1 Protein (Met1-Cys79), C-His tagged | +Inquiry |
SPINK1-6346H | Recombinant Human SPINK1 Protein (Asp24-Cys79), N-GST tagged | +Inquiry |
SPINK1-243H | Recombinant Human serine peptidase inhibitor, Kazal type 1, His-tagged | +Inquiry |
SPINK1-5710R | Recombinant Rat SPINK1 Protein | +Inquiry |
SPINK1-1785H | Recombinant Human SPINK1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPINK1-1511HCL | Recombinant Human SPINK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPINK1 Products
Required fields are marked with *
My Review for All SPINK1 Products
Required fields are marked with *
0
Inquiry Basket